Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49064.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:220 amino acids
:REPEAT 2|17->107|108->202

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49064.1 GT:GENE ABO49064.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 561472..562134 GB:FROM 561472 GB:TO 562134 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49064.1 GB:DB_XREF GI:134051093 LENGTH 220 SQ:AASEQ MLTGRASAHWLRSAPLSFSPPGQRALLWGNPFGVQPASPAPFTAAPLHYAKVLRPAGAFLLGPKPHTGGNSLGVRFWVMNSHQSACRALGSRPPLTHSVLLRCTPCVSFGLSGVILWGHGPHLASGPLGGNVRGPVPLAKCLQCLRVRSPAAACLLLLGQGFGVRHPAFPWGQAFVPASAGRTFGSAQRLPAAASPSRCPCVERCSPMLAAVSGFTQSKR GT:EXON 1|1-220:0| NREPEAT 1 REPEAT 2|17->107|108->202| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,217-221| PSIPRED cccccccHHHHHHccccccccccEEEEcccccccccccccccccccHHHHHHHcccccEEEccccccccccEEEEEEEEcccHHHHHHHcccccccEEEEEEEccHHHccccEEEEEccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHHHHHccc //