[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49068.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.41.1d.142.2
:743 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   298->521 1wmdA PDBj 6e-08 26.1 %
:RPS:PDB   266->568 1ea7A PDBj 3e-14 16.0 %
:RPS:SCOP  10->124 1b04A  d.142.2.2 * 8e-04 15.8 %
:RPS:SCOP  266->551 1ga1A  c.41.1.2 * 2e-15 15.1 %
:HMM:SCOP  265->585 1v6cA_ c.41.1.1 * 1.3e-28 29.1 %
:RPS:PFM   427->528 PF00082 * Peptidase_S8 2e-05 45.7 %
:HMM:PFM   297->527 PF00082 * Peptidase_S8 3.5e-09 24.6 183/307  
:BLT:SWISS 348->644 Y4BN_RHISN 7e-25 33.0 %
:PROS 508->518|PS00138|SUBTILASE_SER

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49068.1 GT:GENE ABO49068.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 564410..566641 GB:FROM 564410 GB:TO 566641 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: dsy:DSY3405 hypothetical protein GB:PROTEIN_ID ABO49068.1 GB:DB_XREF GI:134051097 InterPro:IPR000209 LENGTH 743 SQ:AASEQ MDDDKQRPHLWIPEEEVDRLNNEPQGRNKPRDVTHGEHGKKLSRALEAIVAYYKEMPQGALPEDLVVFKVLLPESEKLDNKQRRKFLEDNGLTVNAVKDRRNAVVSTTPHLFQRLRNRIENYRERGKFTDFQYIDGFEPFTVSDKQASGIRRLFLQGDKPPEKVDIQLMLMPNLTSGKYESAMSKMRGSIEQVCGEYVEDFILSDGTPVVRTIIPSMAIEWISQDDSVYRVEETKFFTAVEGEETDTFLPMSLELNPEIALDALPVVVILDTGIQLPEPLNQLVFTRWVADGVTPGDNPHGTAVASRAIFGTDLANQLIENDVLTPRVRVLDAVVLDGEVSDIAYMKRVRKAVEQLSGISKIFNISANIKESPIEGDEISITGYELDNLMRLHDVQFLISSGNHKVWPTADSLEEVLDDDDTRISAPADSMLGITVGAIAGREHPLSLSKVNEIAPFSRRGPGFAGFTKPDLVSYGGNAYYDAEGKKFVNDRRALVLIPNGETRFVGGTSFAAPVVAGDLAVIASQIPGGDILMAKALLYHGAAPLWDDDGLQIEDLEFIANLYGRGLSDPDRSLFSSPSRVTFVRAGELDRLTKEHVRFHMPSVLAAKPGRNTARVTVTCVSKPPIYRDKGQEYLGAFISASLHKVGNGEKLPSVNPKGGFGRRNWDVCHHFWNNFSKFNAGDWQVWLELRTRWDVTNDVKIPYAMAITIEDLSGDIDIYNEILNETRGRFMPMTSIHIPVR GT:EXON 1|1-743:0| BL:SWS:NREP 1 BL:SWS:REP 348->644|Y4BN_RHISN|7e-25|33.0|294/431| PROS 508->518|PS00138|SUBTILASE_SER|PDOC00125| BL:PDB:NREP 1 BL:PDB:REP 298->521|1wmdA|6e-08|26.1|199/434| RP:PDB:NREP 1 RP:PDB:REP 266->568|1ea7A|3e-14|16.0|269/309| RP:PFM:NREP 1 RP:PFM:REP 427->528|PF00082|2e-05|45.7|81/285|Peptidase_S8| HM:PFM:NREP 1 HM:PFM:REP 297->527|PF00082|3.5e-09|24.6|183/307|Peptidase_S8| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00082|IPR000209| GO:PFM GO:0006508|"GO:proteolysis"|PF00082|IPR000209| RP:SCP:NREP 2 RP:SCP:REP 10->124|1b04A|8e-04|15.8|101/310|d.142.2.2| RP:SCP:REP 266->551|1ga1A|2e-15|15.1|278/370|c.41.1.2| HM:SCP:REP 265->585|1v6cA_|1.3e-28|29.1|265/0|c.41.1.1|1/1|Subtilisin-like| OP:NHOMO 34 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------2-----------------------------------------------------------------1--1-----------------------------------------------------------1-------------------------------------------1----------1------1---111-------------------------3----1------------1-----------1-1--1-----1---------------------------------------------1-------------1--1------------------------------------------------------------------------1------------------------------------------------11--------------1-----1-------------------------------------------------------------------------------------------------------------------1-----------1------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------1------------1------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 366 STR:RPRED 49.3 SQ:SECSTR ############################################################################################################################################################################################################cccccEEEEccccccccGGGTTTEEEEETcccccc#####cccccccHHHHHHHTTccTTcEEEEEEccccTTcTTTTTTEEEcccccccEETcccccccHHHHHHHHHHcTTccccccccTTcEEEEEEcccTTccccHHHHHHHHHHHHHHHHTccEEEEccEEEccccccccHHHHHHHHHHHHTTcEEEEEEcccccccTTcccccccccccTTccccTTTcTTcEEEEEEEEEEETTEEEEccccccTTTTTcccccTTcccEEEEcccEEEEETTEEEccEEEEcccEcTTccEEEEccHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHTccccccTTccccccTTTcTccccccHHHHT######################################################################################################################################################################## DISOP:02AL 1-5,16-34,741-744| PSIPRED cccccccccccccHHHHHHHHcccccccccccccHHHccHHHHHHHHHHHHHHHHccccccccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEcccEEEEEEccHHHHHHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccccccHHHHHHcccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccHHHcccccccccccccccccccccEEEEEEEEcccccccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccHHccccEEEEEEEcccccccccccccEEEEEcccccccccEEEEEEEccccEEEccccccccccccccEEcccccEEEEcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccEEEEEEcccccccccEEEEEEcccccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEEEcccccccccccccccccccccccHHEEccccccccccccEEEEEEcccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHccccccEEcccc //