[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49082.1
DDBJ      :             CRISPR-associated protein Cas5, Hmari subtype
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:242 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->162 PF09704 * Cas_Cas5d 1.7e-15 26.1 142/216  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49082.1 GT:GENE ABO49082.1 GT:PRODUCT CRISPR-associated protein Cas5, Hmari subtype GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 583105..583833 GB:FROM 583105 GB:TO 583833 GB:DIRECTION + GB:PRODUCT CRISPR-associated protein Cas5, Hmari subtype GB:NOTE TIGRFAM: CRISPR-associated protein Cas5, Hmari subtype; CRISPR-associated protein Cas5 KEGG: hma:pNG4050 hypothetical protein GB:PROTEIN_ID ABO49082.1 GB:DB_XREF GI:134051111 InterPro:IPR013421 InterPro:IPR013422 LENGTH 242 SQ:AASEQ MMKLIAFRLSGRFGHFLRAEAGTSALSYPVPPRTVLLGILGAVLGLEKDLPQELLEPLHIALAGPVPQSHWHKAKLRKDPPEALPQVVKNNQKQEKTTKPEMATLITQEWLFNPAYTIWVALPEPYHQQLEQRLKERCWHFQPCLGLSEMMADIEYLGTLMAEKLPRGSYPVTSIIPQEQAKLDLTQVYDQELALQPLRMPRTVTSSRVFGHSSYFIETKGHPVMVETEQAYQVGDRVLMFI GT:EXON 1|1-242:0| SEG 35->46|vllgilgavlgl| HM:PFM:NREP 1 HM:PFM:REP 5->162|PF09704|1.7e-15|26.1|142/216|Cas_Cas5d| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -----------------------------1---1---------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccEEEEEEEEcccEEEcccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHcEEEEEEcccccEEEEEEEccccccccEEEEcccccccccccccccEEEEEEEEccEEEEEEEccccHHHHHHHHHHccEEEEEccccccccccccEEEEEEEEEEEccccccccccccHHHHHccccccccccccEEEcccEEEcccEEEEEEEEEEEEccccEEEEccccEEEEccEEEEEc //