[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49086.1
DDBJ      :             CRISPR-associated protein Cas2
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.58
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->81 2i0xA PDBj 4e-17 46.8 %
:RPS:SCOP  1->83 2i0xA1  d.58.58.1 * 4e-22 42.2 %
:HMM:SCOP  1->79 1zpwX1 d.58.58.1 * 3.2e-22 41.8 %
:RPS:PFM   1->76 PF09827 * CRISPR_Cas2 2e-07 40.8 %
:HMM:PFM   1->74 PF09827 * CRISPR_Cas2 9.1e-25 43.2 74/79  
:BLT:SWISS 1->87 Y386_METJA 4e-18 44.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49086.1 GT:GENE ABO49086.1 GT:PRODUCT CRISPR-associated protein Cas2 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 589367..589630 GB:FROM 589367 GB:TO 589630 GB:DIRECTION + GB:PRODUCT CRISPR-associated protein Cas2 GB:NOTE TIGRFAM: CRISPR-associated protein Cas2 PFAM: protein of unknown function DUF196 KEGG: dsy:DSY2763 hypothetical protein GB:PROTEIN_ID ABO49086.1 GB:DB_XREF GI:134051115 InterPro:IPR003799 LENGTH 87 SQ:AASEQ MFVILVYDVNQKRVAKVLKRCRQYLTWVQNSVLEGEISDVNLKKLKMELQKIINKEEDSVIFYTMRTTNYSSRELIGLQKNEEGNII GT:EXON 1|1-87:0| BL:SWS:NREP 1 BL:SWS:REP 1->87|Y386_METJA|4e-18|44.8|87/114| BL:PDB:NREP 1 BL:PDB:REP 1->81|2i0xA|4e-17|46.8|79/84| RP:PFM:NREP 1 RP:PFM:REP 1->76|PF09827|2e-07|40.8|76/77|CRISPR_Cas2| HM:PFM:NREP 1 HM:PFM:REP 1->74|PF09827|9.1e-25|43.2|74/79|CRISPR_Cas2| RP:SCP:NREP 1 RP:SCP:REP 1->83|2i0xA1|4e-22|42.2|83/84|d.58.58.1| HM:SCP:REP 1->79|1zpwX1|3.2e-22|41.8|79/0|d.58.58.1|1/1|TTP0101/SSO1404-like| OP:NHOMO 90 OP:NHOMOORG 72 OP:PATTERN -----------------------11--1----12111------------111---1-11111-1---- -----------------------------------------1-1-----------------1-----------------------12111----11--------------------------------1-----1----------1------------------------------------------21--1---------1---------------2----------1---------------------------------------------------------------------------------------------21---------------111--1--1------1113112--111113111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3214311111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 90.8 SQ:SECSTR cEEEEEEEcccccHHHHHHHHTTTcEEEETTEEEEEccHHHHHHHHHHHHHcccTTTcEEEEEEEc##ccccccccccccc###### DISOP:02AL 81-85| PSIPRED cEEEEEEEccHHHHHHHHHHHHHHcccHHEEEEEEEEcHHHHHHHHHHHHHHccccccEEEEEEccccccEEEEEEccccccccccc //