[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49090.1
DDBJ      :             redox-active disulfide protein 2
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  127/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->75 1iloA PDBj 1e-16 40.0 %
:RPS:PDB   3->77 1bedA PDBj 1e-07 15.3 %
:RPS:SCOP  3->75 1iloA  c.47.1.1 * 2e-07 39.7 %
:HMM:SCOP  1->76 1iloA_ c.47.1.1 * 2.3e-19 30.3 %
:HMM:PFM   8->59 PF00462 * Glutaredoxin 1e-05 28.0 50/60  
:HMM:PFM   55->76 PF02272 * DHHA1 6.7e-05 45.5 22/68  
:BLT:SWISS 3->73 Y581_METJA 3e-10 31.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49090.1 GT:GENE ABO49090.1 GT:PRODUCT redox-active disulfide protein 2 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 592709..592948 GB:FROM 592709 GB:TO 592948 GB:DIRECTION + GB:PRODUCT redox-active disulfide protein 2 GB:NOTE KEGG: chy:CHY_1096 redox-active disulfide protein 2 GB:PROTEIN_ID ABO49090.1 GB:DB_XREF GI:134051119 LENGTH 79 SQ:AASEQ MEIKVLGTGCQKCKEVEKLVREVLAEINVPANVEKVEDIAQIVQYGVMLTPGLVINGKVKVSGRVPNKADIKKLIEEEK GT:EXON 1|1-79:0| BL:SWS:NREP 1 BL:SWS:REP 3->73|Y581_METJA|3e-10|31.4|70/86| BL:PDB:NREP 1 BL:PDB:REP 1->75|1iloA|1e-16|40.0|75/77| RP:PDB:NREP 1 RP:PDB:REP 3->77|1bedA|1e-07|15.3|72/181| HM:PFM:NREP 2 HM:PFM:REP 8->59|PF00462|1e-05|28.0|50/60|Glutaredoxin| HM:PFM:REP 55->76|PF02272|6.7e-05|45.5|22/68|DHHA1| RP:SCP:NREP 1 RP:SCP:REP 3->75|1iloA|2e-07|39.7|73/77|c.47.1.1| HM:SCP:REP 1->76|1iloA_|2.3e-19|30.3|76/77|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 167 OP:NHOMOORG 145 OP:PATTERN -----------------------1-----1----1--121111-112112222--------------- --------------------------------1---------------1---------------------------1-------------21-1-------------------------------1111112112111111111---------------------1--1-----------------------1-----------------------------------------------------------------------------------------1----------------------------------------112------------1-22------------1111121-111121-11---1------------------11111-------------------------------------2------11--------------------------------------------------------------------------------------1-------------1-1----11---------------1-2-11-112--21-----111111121111--121---1----------------1-11----1---1---1-1111-1-111111-121---1--1-----------------------------------------------------------------------------------------------------------1-----------------------------------------------------1------------------------------11----------------1-------------------------1111111111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 98.7 SQ:SECSTR EEHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHHHTcccccEEEETTTEcGGGTcccHHHHHHHHHHH# DISOP:02AL 79-80| PSIPRED cEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHcccccccEEEEccEEEEEcccccHHHHHHHHHHcc //