[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49091.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.152.1
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->50 1vkeF PDBj 1e-04 37.0 %
:RPS:PDB   5->47 3beyD PDBj 3e-06 37.2 %
:RPS:SCOP  5->48 2cwqA1  a.152.1.4 * 9e-07 27.3 %
:HMM:SCOP  5->50 1p8cF_ a.152.1.2 * 1.2e-06 48.8 %
:HMM:PFM   3->55 PF02627 * CMD 3e-10 34.0 53/85  
:HMM:PFM   38->83 PF10728 * DUF2520 0.00022 28.3 46/132  
:BLT:SWISS 5->48 YNQ6_PARDE 4e-04 47.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49091.1 GT:GENE ABO49091.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 592972..593232 GB:FROM 592972 GB:TO 593232 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49091.1 GB:DB_XREF GI:134051120 LENGTH 86 SQ:AASEQ MGANLDAKTLALIGVGASVGANCFPCLEQKVTEALKAGASVEEIAQAVQLGEEAKMQPNQGIKALAEMLLQNAQSLLDRGSAGGCG GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 5->48|YNQ6_PARDE|4e-04|47.7|44/100| BL:PDB:NREP 1 BL:PDB:REP 5->50|1vkeF|1e-04|37.0|46/97| RP:PDB:NREP 1 RP:PDB:REP 5->47|3beyD|3e-06|37.2|43/93| HM:PFM:NREP 2 HM:PFM:REP 3->55|PF02627|3e-10|34.0|53/85|CMD| HM:PFM:REP 38->83|PF10728|0.00022|28.3|46/132|DUF2520| RP:SCP:NREP 1 RP:SCP:REP 5->48|2cwqA1|9e-07|27.3|44/117|a.152.1.4| HM:SCP:REP 5->50|1p8cF_|1.2e-06|48.8|43/115|a.152.1.2|1/1|AhpD-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 79.1 SQ:SECSTR HcccccHHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTTccHHHHHHHHGGGccccHHHHHHHHHHHHH################## DISOP:02AL 1-6,84-87| PSIPRED ccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHcccccccc //