[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49095.1
DDBJ      :             cytochrome c biogenesis protein, transmembrane region
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
:223 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->185 PF02683 * DsbD 2e-13 36.9 %
:HMM:PFM   19->219 PF02683 * DsbD 1.6e-37 35.3 201/211  
:BLT:SWISS 29->189 DSBD_VIBCH 2e-11 27.5 %
:TM
:REPEAT 2|29->69|141->179
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49095.1 GT:GENE ABO49095.1 GT:PRODUCT cytochrome c biogenesis protein, transmembrane region GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 595134..595805 GB:FROM 595134 GB:TO 595805 GB:DIRECTION + GB:PRODUCT cytochrome c biogenesis protein, transmembrane region GB:NOTE PFAM: cytochrome c biogenesis protein, transmembrane region KEGG: sat:SYN_01815 thiol:disulfide interchange protein GB:PROTEIN_ID ABO49095.1 GB:DB_XREF GI:134051124 InterPro:IPR003834 LENGTH 223 SQ:AASEQ MPALETLLAGSLLFSLLAALTAGLFSGISPCTLPTAVMVVAYVGGYDNRSRLKGFILSLSFVLGLSLTLAIAGAVVSAVGGLFMGSKVVWYLAALVAVLMGANLLGLFKLPGFGVNPTGVKQGSGVLGAFLLGIPFAIIASPCTAPITATVLAYAATKGSVWYGFTLLFAYAIGRSIPLLAAGTFTSVLKNASKFENFSLVVQRISGMALIGLGFYLLYGIVD GT:EXON 1|1-223:0| BL:SWS:NREP 1 BL:SWS:REP 29->189|DSBD_VIBCH|2e-11|27.5|160/600| TM:NTM 6 TM:REGION 13->35| TM:REGION 57->79| TM:REGION 91->113| TM:REGION 129->151| TM:REGION 164->186| TM:REGION 198->220| NREPEAT 1 REPEAT 2|29->69|141->179| SEG 3->25|aletllagsllfsllaaltaglf| SEG 72->81|agavvsavgg| SEG 88->99|vvwylaalvavl| SEG 210->221|liglgfyllygi| RP:PFM:NREP 1 RP:PFM:REP 26->185|PF02683|2e-13|36.9|160/209|DsbD| HM:PFM:NREP 1 HM:PFM:REP 19->219|PF02683|1.6e-37|35.3|201/211|DsbD| GO:PFM:NREP 3 GO:PFM GO:0016020|"GO:membrane"|PF02683|IPR003834| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF02683|IPR003834| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02683|IPR003834| OP:NHOMO 108 OP:NHOMOORG 105 OP:PATTERN -------------------------------------------------------------------- 1------------------------------------------------------------------------------------1------------------------------------------------------------111111------1------111111---1-----1--------------------------------------1----1---------------------------------------------------------------------------111111-111111------------1-111-1111-1------11111---1----1--1----1---1----------------1-111-----1-1-------------1--------------11-111--12------11111----------------------------------------------------------------------------------------------------------1------------------1--------1-----112-1--1--1-1-11-1-----------------------------21--------------------1------------------------------------------------------------------------------------------------------------1111----------1---------------1------------------------------------11111------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1----1111-1-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 44-55,110-126| PSIPRED ccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcc //