[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49101.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.11
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->130 2hu9B PDBj 1e-13 35.7 %
:RPS:SCOP  33->116 2gl5A1  c.1.11.2 * 2e-04 9.6 %
:HMM:PFM   83->123 PF04324 * Fer2_BFD 6.4e-11 39.5 38/54  
:HMM:PFM   15->66 PF04606 * Ogr_Delta 1.6e-05 27.3 44/47  
:BLT:SWISS 15->130 COPZ_ARCFU 4e-13 35.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49101.1 GT:GENE ABO49101.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 600242..600637 GB:FROM 600242 GB:TO 600637 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: mta:Moth_1121 hypothetical protein GB:PROTEIN_ID ABO49101.1 GB:DB_XREF GI:134051130 LENGTH 131 SQ:AASEQ MICGSKTLLSKAALCPKCGGRGKGMRSDTLRHMIQNHRIPKVLEGYQLCLNPDCSVVYFGSEVFTKEDLMTRVWFKETDPDVPVCYCKEVTTGDILEHIVQRGCCQNLQDIQNHTGANTGKECLTKNPAGT GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 15->130|COPZ_ARCFU|4e-13|35.7|112/204| BL:PDB:NREP 1 BL:PDB:REP 15->130|2hu9B|1e-13|35.7|112/129| HM:PFM:NREP 2 HM:PFM:REP 83->123|PF04324|6.4e-11|39.5|38/54|Fer2_BFD| HM:PFM:REP 15->66|PF04606|1.6e-05|27.3|44/47|Ogr_Delta| RP:SCP:NREP 1 RP:SCP:REP 33->116|2gl5A1|2e-04|9.6|83/278|c.1.11.2| OP:NHOMO 28 OP:NHOMOORG 22 OP:PATTERN -----------------------1-------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------1-----------------------------------1-------------------------------------------------------------------------------------------------------131--------------------1--21------1-1----111--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------4- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 85.5 SQ:SECSTR ##############cTTTccccEEEcHHHHHHHccGGGGGGccccEEEcccTTccEEEEcccEEEGGGcccccGGGccccccEEETTTTEEHHHHHHHHHHHc####HHHHHHHHTTTccccHHHHcTTc# DISOP:02AL 1-4,6-7,129-132| PSIPRED cccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccEEcccccccEEEEcccEEEEHHEEEEEEEccccccccEEEEccccHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccc //