[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49105.1
DDBJ      :             transcriptional regulator, ArsR family
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  320/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->87 1r1vB PDBj 3e-11 37.0 %
:RPS:PDB   18->100 1bibA PDBj 2e-14 14.5 %
:RPS:SCOP  3->85 1r1uA  a.4.5.5 * 1e-14 34.9 %
:HMM:SCOP  1->95 1u2wA1 a.4.5.5 * 2.4e-24 34.7 %
:RPS:PFM   19->62 PF01022 * HTH_5 4e-09 47.7 %
:HMM:PFM   18->63 PF01022 * HTH_5 1.2e-19 41.3 46/47  
:HMM:PFM   75->101 PF00658 * PABP 0.00076 34.6 26/72  
:BLT:SWISS 7->90 Y1325_METJA 1e-14 41.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49105.1 GT:GENE ABO49105.1 GT:PRODUCT transcriptional regulator, ArsR family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 603210..603536 GB:FROM 603210 GB:TO 603536 GB:DIRECTION + GB:PRODUCT transcriptional regulator, ArsR family GB:NOTE PFAM: regulatory protein, ArsR KEGG: dsy:DSY4143 hypothetical protein GB:PROTEIN_ID ABO49105.1 GB:DB_XREF GI:134051134 InterPro:IPR001845 LENGTH 108 SQ:AASEQ MQEKIAQRKADIFKAISHPTRIRILDLLSDGEHCVCDIFEGLNVEQANTSQHLSVMKKQGILQSRKEGLRVIYSIKNPEVIEMLELANQILKKQAKEAMSAFAGVAEK GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 7->90|Y1325_METJA|1e-14|41.7|84/89| BL:PDB:NREP 1 BL:PDB:REP 7->87|1r1vB|3e-11|37.0|81/96| RP:PDB:NREP 1 RP:PDB:REP 18->100|1bibA|2e-14|14.5|83/294| RP:PFM:NREP 1 RP:PFM:REP 19->62|PF01022|4e-09|47.7|44/47|HTH_5| HM:PFM:NREP 2 HM:PFM:REP 18->63|PF01022|1.2e-19|41.3|46/47|HTH_5| HM:PFM:REP 75->101|PF00658|0.00076|34.6|26/72|PABP| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 3->85|1r1uA|1e-14|34.9|83/94|a.4.5.5| HM:SCP:REP 1->95|1u2wA1|2.4e-24|34.7|95/0|a.4.5.5|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 537 OP:NHOMOORG 345 OP:PATTERN --------1111111-------------1----1111111111--1--2-355--------------1 11111--1111---31-----3--21------13442-11--13-11-1---2-21----111-11--111-----1-------1111-----------1-----1-321---------------1212222111221121111---22133122----1-111112332-11111-11-1----1--13-122222222232222322211111223-1-22-13111--21-11121111111111-11121------1--1-1-------------1--1----------------------------------------226-222132221213-11-222--1-2211-1853211311242-3-1-2-------------11-------------------1-1--11---1---1------211-1-3------2-11----------------1-1----------------------------------------1--111---------------11-121-------1---1-2-1---12---12--------1--14-11-1132-22111-233322522--11-111---------------------1---34------1---13111121131122113322------2---------1--------------------------------------1----------------------------2------------------------11--------------------------1-----------1-----------------1-1--1-11-1--11----------------21111111----------1-------------------------2132111111-2- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHHHHHTcHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccEEEccEETcTTEEEH DISOP:02AL 1-3,107-109| PSIPRED ccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcHHHHHccc //