[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49114.1
DDBJ      :             electron transfer flavoprotein beta-subunit
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  451/915 : Eukaryota  44/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->244 1efpB PDBj 3e-13 25.6 %
:RPS:PDB   1->246 1efpB PDBj 5e-32 24.9 %
:RPS:SCOP  1->246 1efpB  c.26.2.3 * 2e-32 24.9 %
:HMM:SCOP  1->247 1efpB_ c.26.2.3 * 3.3e-61 32.8 %
:RPS:PFM   27->178 PF01012 * ETF 2e-10 30.3 %
:HMM:PFM   27->185 PF01012 * ETF 3.5e-37 33.8 154/164  
:BLT:SWISS 1->255 YDIQ_ECOLI 1e-60 46.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49114.1 GT:GENE ABO49114.1 GT:PRODUCT electron transfer flavoprotein beta-subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 614438..615208 GB:FROM 614438 GB:TO 615208 GB:DIRECTION + GB:PRODUCT electron transfer flavoprotein beta-subunit GB:NOTE PFAM: electron transfer flavoprotein beta-subunit KEGG: dsy:DSY3798 hypothetical protein GB:PROTEIN_ID ABO49114.1 GB:DB_XREF GI:134051143 InterPro:IPR000049 LENGTH 256 SQ:AASEQ MRVITCCKAVPEEQDIVVAKDRQISFEKAEWKFGPYDLNAVEAGKQIVEAVGGQLSGLCAGGKILDNSKLKKDILSRGLDDLYVVMDETMEQADTYQSARVLEAAIKKMGDFDLVLCGVGSSDLYAQQVGNQLGELLGLPVVNAVNKITAQGDKVIVERALEDAIEVLEISLPAVLSVTSEINVPRIAGMKDIIAANKKPVKKFNLSEIEVADIQPSSMVLSTLAPEQVDRRLNILEGESDEVVDAFVKLLSAELK GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 1->255|YDIQ_ECOLI|1e-60|46.2|253/254| BL:PDB:NREP 1 BL:PDB:REP 24->244|1efpB|3e-13|25.6|215/246| RP:PDB:NREP 1 RP:PDB:REP 1->246|1efpB|5e-32|24.9|241/246| RP:PFM:NREP 1 RP:PFM:REP 27->178|PF01012|2e-10|30.3|145/157|ETF| HM:PFM:NREP 1 HM:PFM:REP 27->185|PF01012|3.5e-37|33.8|154/164|ETF| RP:SCP:NREP 1 RP:SCP:REP 1->246|1efpB|2e-32|24.9|241/246|c.26.2.3| HM:SCP:REP 1->247|1efpB_|3.3e-61|32.8|241/246|c.26.2.3|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 780 OP:NHOMOORG 522 OP:PATTERN 22----2222222222-2132221-111--1------------------------------3322--- 11211-11--111111111-1111111111111111111111111--11----11-11--11211111121--------142------11111122---1-----111-----------------11-111111-111122---11-------11-----------1----------------1-1----11211111111111111111111111111131111------21----------------------1-------------------------------------------------------------------1532444444443431422422214-1-1-12-873463-141--11-2-12-1--------12-1-1-11111211111111111-112113-1-21-1---111112--22-1-111111111111111111122-1222-----------------------------1121-1-1--2111221-111111211111112421112---112-22222---1111--11-1----------13115321----------6471925--11-11114-------------------------1111-111112--11111113111-2132-11-----1-------1-1-1--2222222221-2222222222222222221-------13221333332313113--112221-----------------1----------1111---------------------11114-1111-1-11----1111-------------------1--1111111111111111---1111111----------1-------------------------1111112111--- -----1---------------------111111----------1-----------------------1-111-1-11111-------1---1--1-----111112---------------11-----------------------------------1------------------1-----1-1111-111-21111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 100.0 SQ:SECSTR cEEEEEccEEEcTcccccTTccccccTTccEEEcHHHHHHHHHHHHHHTTTcccEEEEEEEcGTHGGHHHHHHHHHHTccEEEEEEccccTTccccHHHHHHHHHHHHHHTccEEEEEcccTTTccccHHHHHHHHHTcEEEEEEEEEEEcccEEEEEEEETTEEEEEEEEccEEEEEcTTccccccccHHHHHHHTTccEEEEEGGGGTcGcccccccccccccccccccccccccccHHHHHTTHHHHHHHHHc DISOP:02AL 222-238,256-257| PSIPRED cEEEEEEEEcccccEEEEcccccEEEccccEEccHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHcccEEEEEEEEEEEccEEEEEEEccccEEEEEEcccEEEEEcccccccccccHHHHHHHcccEEEEEcHHHccccccccccEEEEEEEccccccccEEEEccHHHHHHHHHHHHHHHHc //