[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49122.1
DDBJ      :             sigma54 specific transcriptional regulator, Fis family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  624/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
a.4.1c.1.26c.37.1d.110.3
:494 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   173->482 1ojlD PDBj 6e-54 37.6 %
:RPS:PDB   44->136 2a24B PDBj 5e-09 15.1 %
:RPS:PDB   173->229 1bqgA PDBj 3e-05 7.0 %
:RPS:PDB   200->492 3e2tA PDBj 3e-51 11.7 %
:RPS:SCOP  44->138 1p97A  d.110.3.7 * 1e-08 12.6 %
:RPS:SCOP  150->367 1lt7A  c.1.26.1 * 4e-51 12.4 %
:RPS:SCOP  384->486 1ntcA  a.4.1.12 * 5e-18 23.3 %
:HMM:SCOP  44->136 1v9yA_ d.110.3.2 * 7.8e-08 20.7 %
:HMM:SCOP  172->419 1ny5A2 c.37.1.20 * 3.8e-64 36.2 %
:HMM:SCOP  385->486 1etoB_ a.4.1.12 * 3.1e-16 32.7 %
:RPS:PFM   34->113 PF08448 * PAS_4 6e-04 31.3 %
:RPS:PFM   173->338 PF00158 * Sigma54_activat 2e-45 52.4 %
:RPS:PFM   445->482 PF02954 * HTH_8 1e-05 47.4 %
:HMM:PFM   173->338 PF00158 * Sigma54_activat 2.3e-65 53.6 166/168  
:HMM:PFM   445->483 PF02954 * HTH_8 2.6e-14 51.3 39/42  
:HMM:PFM   28->134 PF00989 * PAS 1.2e-06 19.8 101/113  
:HMM:PFM   86->223 PF00437 * GSPII_E 0.00018 19.6 102/282  
:BLT:SWISS 29->482 ROCR_BACSU 1e-98 43.3 %
:PROS 197->210|PS00675|SIGMA54_INTERACT_1
:PROS 385->394|PS00688|SIGMA54_INTERACT_3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49122.1 GT:GENE ABO49122.1 GT:PRODUCT sigma54 specific transcriptional regulator, Fis family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(623601..625085) GB:FROM 623601 GB:TO 625085 GB:DIRECTION - GB:PRODUCT sigma54 specific transcriptional regulator, Fis family GB:NOTE KEGG: bcz:BCZK0403 transcriptional regulator; probable arginine utilization regulatory protein TIGRFAM: PAS sensor protein PFAM: sigma-54 factor, interaction domain-containing protein; helix-turn-helix, Fis-type; ATPase associated with various cellular activities, AAA_5 SMART: AAA ATPase GB:PROTEIN_ID ABO49122.1 GB:DB_XREF GI:134051151 InterPro:IPR000014 InterPro:IPR002078 InterPro:IPR002197 InterPro:IPR003593 InterPro:IPR011704 LENGTH 494 SQ:AASEQ MTKNNLLKSLINFNAAETSCKNVSADYDLVINSLDCLEDCYFSIVDATGKIIFVSKDFEKIDGYKISDILGKNVLDVYKLGKQNSVHVRSIAEKKVLKNTKLRYTSASGQPVDLVMDIYPVFSGREVIGSFAISRDTSKIQALTDKVFQLQKALYNQLQRTNNNGTQFCFDDIIGSGEAMQSVINTAKKMACSESRIMILGETGTGKELFAQSIHNNSSRAKEPFIAVNCSAIPDTLLESILFGTNKGAFTGAEDKAGLFEEAKNGTLFLDELNSMSIVLQSKLLRALETNRIRRVGGNKEIPVNPRIISAMNIDPKEAIETEKLRSDFYYRLAVITLECPPLRNRKEDIITLSWFYINKYNKILGRKINEISEEVIQILENYNWPGNVRELSHCIEHAMNIVDPTDTSLLVQHLPAFLQDKILKNNILPITVPKINDYKQIMLQVEKDLLTQALKRNTGNINQTAKELNLSRQCLYYKLKRLDIDIQHEIYIE GT:EXON 1|1-494:0| BL:SWS:NREP 1 BL:SWS:REP 29->482|ROCR_BACSU|1e-98|43.3|441/461| PROS 197->210|PS00675|SIGMA54_INTERACT_1|PDOC00579| PROS 385->394|PS00688|SIGMA54_INTERACT_3|PDOC00579| BL:PDB:NREP 1 BL:PDB:REP 173->482|1ojlD|6e-54|37.6|295/297| RP:PDB:NREP 3 RP:PDB:REP 44->136|2a24B|5e-09|15.1|93/108| RP:PDB:REP 173->229|1bqgA|3e-05|7.0|57/399| RP:PDB:REP 200->492|3e2tA|3e-51|11.7|265/307| RP:PFM:NREP 3 RP:PFM:REP 34->113|PF08448|6e-04|31.3|67/111|PAS_4| RP:PFM:REP 173->338|PF00158|2e-45|52.4|166/168|Sigma54_activat| RP:PFM:REP 445->482|PF02954|1e-05|47.4|38/42|HTH_8| HM:PFM:NREP 4 HM:PFM:REP 173->338|PF00158|2.3e-65|53.6|166/168|Sigma54_activat| HM:PFM:REP 445->483|PF02954|2.6e-14|51.3|39/42|HTH_8| HM:PFM:REP 28->134|PF00989|1.2e-06|19.8|101/113|PAS| HM:PFM:REP 86->223|PF00437|0.00018|19.6|102/282|GSPII_E| GO:PFM:NREP 6 GO:PFM GO:0005524|"GO:ATP binding"|PF00158|IPR002078| GO:PFM GO:0005622|"GO:intracellular"|PF00158|IPR002078| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00158|IPR002078| GO:PFM GO:0008134|"GO:transcription factor binding"|PF00158|IPR002078| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02954|IPR002197| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02954|IPR002197| RP:SCP:NREP 3 RP:SCP:REP 44->138|1p97A|1e-08|12.6|95/114|d.110.3.7| RP:SCP:REP 150->367|1lt7A|4e-51|12.4|209/305|c.1.26.1| RP:SCP:REP 384->486|1ntcA|5e-18|23.3|90/91|a.4.1.12| HM:SCP:REP 44->136|1v9yA_|7.8e-08|20.7|92/0|d.110.3.2|1/1|PYP-like sensor domain (PAS domain)| HM:SCP:REP 172->419|1ny5A2|3.8e-64|36.2|246/247|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 385->486|1etoB_|3.1e-16|32.7|98/98|a.4.1.12|1/1|Homeodomain-like| OP:NHOMO 5734 OP:NHOMOORG 631 OP:PATTERN -------------------------------------------------------------------- 7LN-----------------------------------------------------------------------------1--63965999A27331--336356I5C651111111111111113337435775411-1----1-1111-----11------11--111---------------------5147777777858767778966658882693611323333O1--------------------5----1-----11------2---------------------------------------------------HI3KDCCEDCE7D7-N44511216---9-14-aX8HD92DA497A-12-CDG444422222B8CAB444AC66933233332335-A89898974841866567766687BF54355AB9BC35622222222A442277E11111111--111111111111111----15888546538LLMKMKFCCCCJJKOEFEE8CKMLHMJG-1DFDGH877EFBCC887DAC799711-----343HLJCerLMOfVEdNbbe6adbcUUgLPcefhq*KV-111-111111111111111121--DCFBAABAKBBA6ECBBBEGFHFEFFBFFEII--2BGAJ------E79B966DBBEDCEFDD-BECCFDDDCCBCEDDCDDCCDC99776DACCBDEDCEDBEBCD9986A9A94-655676655787---3-----3333A3N9K1112111111111123344326121Q9MNMNLOMMMMPMKENLJ---------68CDGEEEFEEJFGF67A88886672222--F13333331111111142--------------------------13111-1---7A2 -1------------------------------------------------------------------------------------------------------------------------------------------------------------4-----------3--2-----------1--4-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 479 STR:RPRED 97.0 SQ:SECSTR ###############HHHHHHHHTccHHHHHTTcccEccEEEEEEcTTccEEEEcTTHHHHTcccHHHHcTccGGGGccGGGHHHHHHHHHHHcccEEEEEEEEEcTTccEEEEEEEEEEEEccccEEEEccEEEEcHHHHHHHHHHHHTccccHHHHHHHHHHHHTEEHHHHHHHHHHHHcHHHHHHcccccccEEEEEEccTTTcccccHHHHcHHHHHHHHHHHHHHHccTTcccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHTHHHHHHHHcccTTccccHHHHHHHHHHHHccEEEcccEEcHHHHHHHHHTTEEEEccccccTTcTTccccHHHHHHTHHHHTcHHHHHHHHHHHHHHTTccHHHHHHHHTTTTTcEEEETTEEEEccHHHHTcccHHHHHHHTcccccHHHHTcTTccccccTTTccccccccGEEEccHHHHTTcccccccccccEEEcHHHHHHHHHHHHTTccccccEc DISOP:02AL 1-4,150-171,418-435,488-495| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEHHHHHHHcccHHHHccccHHHHHHccccccHHHHHHHcccccccEEEEEEEccccEEEEEEEEEEEEEccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHccccccccccccccccHHHcccccEEEEEEHHcccHHHHHHHHHHHHcccEEEcccccEEEEEEEEEEcccccHHHHHHccccHHHHHHHHcEEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccEEcHHHccHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHccccHHHHHcc //