[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49127.1
DDBJ      :             GCN5-related N-acetyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  101/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:169 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->162 1wk4A PDBj 2e-30 40.4 %
:RPS:PDB   3->139 3dr8A PDBj 3e-13 18.2 %
:RPS:SCOP  1->139 1yr0A1  d.108.1.1 * 3e-17 19.4 %
:HMM:SCOP  1->152 2ganA1 d.108.1.1 * 6.5e-24 27.3 %
:RPS:PFM   85->139 PF08445 * FR47 2e-04 30.9 %
:HMM:PFM   83->145 PF08445 * FR47 5e-13 33.3 63/86  
:BLT:SWISS 3->167 YUAI_BACSU 4e-28 35.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49127.1 GT:GENE ABO49127.1 GT:PRODUCT GCN5-related N-acetyltransferase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(635062..635571) GB:FROM 635062 GB:TO 635571 GB:DIRECTION - GB:PRODUCT GCN5-related N-acetyltransferase GB:NOTE PFAM: GCN5-related N-acetyltransferase KEGG: swo:Swol_1387 hypothetical protein GB:PROTEIN_ID ABO49127.1 GB:DB_XREF GI:134051156 InterPro:IPR000182 LENGTH 169 SQ:AASEQ MKIREAHINDAPAISKVTVDTWKTAYRGIISDEYLNNLSYEEREKGWREFPFHNSFIYVAENETQNIIGFAAAGPERTSNPVYSGELYAIYIYKDQQNKGIGSSLIRSVMKRFEQLGIYSVLVWVLSESPYRRFYERNGGYKIDSKLLEMDGFKSEVTAYGWLDIRAKF GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 3->167|YUAI_BACSU|4e-28|35.6|163/173| BL:PDB:NREP 1 BL:PDB:REP 1->162|1wk4A|2e-30|40.4|161/173| RP:PDB:NREP 1 RP:PDB:REP 3->139|3dr8A|3e-13|18.2|132/169| RP:PFM:NREP 1 RP:PFM:REP 85->139|PF08445|2e-04|30.9|55/80|FR47| HM:PFM:NREP 1 HM:PFM:REP 83->145|PF08445|5e-13|33.3|63/86|FR47| RP:SCP:NREP 1 RP:SCP:REP 1->139|1yr0A1|3e-17|19.4|134/163|d.108.1.1| HM:SCP:REP 1->152|2ganA1|6.5e-24|27.3|150/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 124 OP:NHOMOORG 102 OP:PATTERN -------------------------------------------------------------------- ------------------------1-------------------1---111-1--1----1------11------------------------------------------------------------------------------------------------------------------1-111---1--2222222212222221111112221111111------------------------------1-11------1--------------------------------------------------------------------------------------------21-1-1---------------------11-111------1--------------------1---1111111111111----------------------------1-----------------------------------------111-11--------------------1--------111-11----2------------------------------------------1------2---------------------------11-----1---------------------------------------------------------------------------------------------------------------------------------1111--1-------------------11-1-------------------------------------------------------------------------------1---------------------------------------- -----3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 97.0 SQ:SECSTR cEEEEccGGGHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHTccEEEEEETETEEEEEEEEEEccccGGGTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHTTccEEEEEETTcHHHHHHHHHTTccccccccccccHTcccEEEEEETT##### PSIPRED cEEEEccHHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHccccccEEEEEEEcccEEEEEEEEEEccccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHcccEEEcEEEEEEccEEEEEEEEEEccccccc //