[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49131.1
DDBJ      :             protein of unknown function DUF833
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  139/915 : Eukaryota  130/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->253 PF05742 * DUF833 2e-66 51.2 %
:HMM:PFM   8->249 PF05742 * DUF833 1.7e-81 44.6 242/273  
:BLT:SWISS 8->262 CV025_BOVIN 1e-47 43.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49131.1 GT:GENE ABO49131.1 GT:PRODUCT protein of unknown function DUF833 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 637453..638244 GB:FROM 637453 GB:TO 638244 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF833 GB:NOTE PFAM: protein of unknown function DUF833 KEGG: swo:Swol_2245 hypothetical protein GB:PROTEIN_ID ABO49131.1 GB:DB_XREF GI:134051160 InterPro:IPR008551 LENGTH 263 SQ:AASEQ MRNKEEVMCLIFFAYNYHPRYQLIVAANRDEFYKRPSLPAAFWRDNPTILAGRDLEQGGTWMGLTTTGCFAALTNYRDPVHNNPQAPSRGYLVHKYLNSDVSPEYYLKNLPNGGAEYNGFNLLVGTTQAIYYYSNREKVIRKIANGIYGLSNGFLNEPWPKVSKGKKALADCLQGQEIKKDQLFKIMADQEQPEDCELPQTGVSLEWERLLSRIFIVSPCYGTRSSTVLMVDRKGHVQFWERSFTMEQPGRGKEVFHEFNIKG GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 8->262|CV025_BOVIN|1e-47|43.3|254/276| RP:PFM:NREP 1 RP:PFM:REP 8->253|PF05742|2e-66|51.2|246/261|DUF833| HM:PFM:NREP 1 HM:PFM:REP 8->249|PF05742|1.7e-81|44.6|242/273|DUF833| OP:NHOMO 330 OP:NHOMOORG 272 OP:PATTERN ---------------------------11--1------------------------------------ ------------------------------------1-11--------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1-----------1-----------------------------------------------------------------------------------------------------1----------------------------------1-1-------------1---------------------------------------------------------------------------------1----1----------------------------------11-111111111111-111111111111111111111111111-----11--111----11----------111-111-----------1-1--1-1-11111---------------------------------11-1-1--1111111111111111111----1---------------------------------------------------------------------------------------------------------111----------------11111111111-11111111111111---------------------------1111111111--------11----------------------------------------------------- ----111-----1111111-111212211111111111111-1111-111111111---111111---------1-1----111-----12-11-11-1---111--12-224111--11-1112113-IF1-41211--21121-11-11--1-1-113--121-111311211---1-111111112112-1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,83-86| PSIPRED ccccccccEEEEEEEcccccccEEEEEccHHHccccccccccccccccEEEcccHHHcccEEEEcccccEEEEEEcccccccccccccccHHHHHHHcccccHHHHHHHHHHHHcccccEEEEEEEcccEEEEcccccccEEccccEEEEEccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccEEEccccccccEEEEEEEEccccEEEEEEEEEcccccccEEEEEEEEEcc //