[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49136.1
DDBJ      :             Hydroxyethylthiazole kinase
Swiss-Prot:THIM_DESRM   RecName: Full=Hydroxyethylthiazole kinase;         EC=2.7.1.50;AltName: Full=4-methyl-5-beta-hydroxyethylthiazole kinase;         Short=Thz kinase;         Short=TH kinase;

Homologs  Archaea  23/68 : Bacteria  298/915 : Eukaryota  98/199 : Viruses  0/175   --->[See Alignment]
c.72.1
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->249 1c3qA PDBj 5e-42 44.1 %
:RPS:PDB   5->262 1ekqA PDBj 3e-28 36.5 %
:RPS:SCOP  5->260 1c3qA1  c.72.1.2 * 1e-29 39.1 %
:HMM:SCOP  4->267 1v8aA_ c.72.1.2 * 1.9e-49 32.4 %
:RPS:PFM   12->255 PF02110 * HK 1e-53 45.1 %
:HMM:PFM   12->253 PF02110 * HK 1.5e-85 49.2 242/246  
:BLT:SWISS 1->266 THIM_DESRM e-139 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49136.1 GT:GENE ABO49136.1 GT:PRODUCT Hydroxyethylthiazole kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 640515..641315 GB:FROM 640515 GB:TO 641315 GB:DIRECTION + GB:PRODUCT Hydroxyethylthiazole kinase GB:NOTE PFAM: hydroxyethylthiazole kinase KEGG: chy:CHY_0748 hydroxyethylthiazole kinase GB:PROTEIN_ID ABO49136.1 GB:DB_XREF GI:134051165 InterPro:IPR000417 LENGTH 266 SQ:AASEQ MQEVQRLWDIRQEVRIKKPLVCNITNTVVTNFTANVLLAVGASPLMSEGWQEADDLAKIVDVLVLNMGTLHPRQVEYFIKAGKSANQEQKPVVFDPVGIGATSYRNAVAAEILDKIKLDLIRGNHGEINFLAGITGQTKGVDSLSNQISVKHLAEFANTTRTLVVSTGEVDYLSDGAKTFTNKTGHAYLQLVTGTGCALSSLAGAFMSVTEDKCLGVLSALAFYGAAAQKAALISQGPGTFAGNFLDALYGLEFDEFKKILEAPKI GT:EXON 1|1-266:0| SW:ID THIM_DESRM SW:DE RecName: Full=Hydroxyethylthiazole kinase; EC=2.7.1.50;AltName: Full=4-methyl-5-beta-hydroxyethylthiazole kinase; Short=Thz kinase; Short=TH kinase; SW:GN Name=thiM; OrderedLocusNames=Dred_0594; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide-binding;Thiamine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->266|THIM_DESRM|e-139|100.0|266/266| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009228|"GO:thiamin biosynthetic process"|Thiamine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 21->36|vcnitntvvtnftanv| BL:PDB:NREP 1 BL:PDB:REP 37->249|1c3qA|5e-42|44.1|213/284| RP:PDB:NREP 1 RP:PDB:REP 5->262|1ekqA|3e-28|36.5|244/253| RP:PFM:NREP 1 RP:PFM:REP 12->255|PF02110|1e-53|45.1|244/246|HK| HM:PFM:NREP 1 HM:PFM:REP 12->253|PF02110|1.5e-85|49.2|242/246|HK| GO:PFM:NREP 2 GO:PFM GO:0004417|"GO:hydroxyethylthiazole kinase activity"|PF02110|IPR000417| GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF02110|IPR000417| RP:SCP:NREP 1 RP:SCP:REP 5->260|1c3qA1|1e-29|39.1|256/272|c.72.1.2| HM:SCP:REP 4->267|1v8aA_|1.9e-49|32.4|262/264|c.72.1.2|1/1|Ribokinase-like| OP:NHOMO 447 OP:NHOMOORG 419 OP:PATTERN -----------------1-----1----1--112----1111111111--111-111---1------- --------111--------------------------1---------1111------------1---------11111-11-1------------------------1---------111--------------1-11111---1----------------------------------------------11111111111111111111111111111112111111111-11111111111111-111111-1-11-1---1111--1-112-111111-------22222222222--------------11---111--1111222222212111111111-1-111-1-11111-1-111111-1--1------------------------------------------------111-11-111----------11111--------------1----------------------------------------------------------------------------1-------1----------1--------------111111111-111----------------11----------1--111111----------1-------1---------------------1----------111111-1111111111-1111111111111111111---11---111111111111111111111111--1--------------------------------1---111111-11111111--1-----------------------------1111-----111-------------------1111111------------------------------------------------1 1-------1----11-1111111111111111111111111111-111111111--111111111111-1111111111111111111-1211111111-111111---1------------------------------------------------------------------11-----112-12-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 98.5 SQ:SECSTR ####HHHHHHHHHHHHHccEEEEEccTTTHHHHHHHHHHHTcEEEccccTTTHHHHHHHccEEEEEcTTccHHHHHHHHHHHHHHHHTTccEEEEcTTcTTcHHHHHHHHHHHHHccccEEEEcHHHHHHHccHHHcGGGcHHHHHTTcHHHHHHHHHHHTcEEEEccccEEEEccccEEEEccccGGGGcGcTTHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHccEEEcccc DISOP:02AL 1-1,138-144| PSIPRED cHHHHHHHHHHHHHHHccccEEEcccHHHHHHccHHHHHHcccHHHHccHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHccccEEcccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccEEEEEccEEEEEcccEEEEEcccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHccc //