[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49140.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  306/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->149 2nnnA PDBj 5e-13 30.1 %
:RPS:PDB   18->151 2a61A PDBj 9e-22 20.9 %
:RPS:SCOP  16->149 2bv6A1  a.4.5.28 * 3e-25 25.8 %
:HMM:SCOP  14->151 1jgsA_ a.4.5.28 * 7.1e-34 32.1 %
:RPS:PFM   45->101 PF01047 * MarR 4e-07 38.6 %
:HMM:PFM   45->101 PF01047 * MarR 2.1e-17 38.6 57/59  
:BLT:SWISS 9->149 MARR_ECOLI 3e-12 32.6 %
:PROS 77->111|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49140.1 GT:GENE ABO49140.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(644312..644791) GB:FROM 644312 GB:TO 644791 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MarR family GB:NOTE PFAM: regulatory protein, MarR KEGG: gsu:GSU1483 transcriptional regulator, MarR family GB:PROTEIN_ID ABO49140.1 GB:DB_XREF GI:134051169 InterPro:IPR000835 LENGTH 159 SQ:AASEQ MHSDMIKNKDNKDLFDIENSLGFLISKTHQYFSLSFKEKLNPFNLTPPQFGALSFLWRQDGISQVQLGTLMGKDRTTIGGIIDRLEKESLVTRQSDPGDRRTNLVYLTAMGAGLKDTLEQRAVQVNSEVTEALTDDERDQLRVLLRKIISNCRYEFSSE GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 9->149|MARR_ECOLI|3e-12|32.6|141/144| PROS 77->111|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 15->149|2nnnA|5e-13|30.1|133/133| RP:PDB:NREP 1 RP:PDB:REP 18->151|2a61A|9e-22|20.9|134/142| RP:PFM:NREP 1 RP:PFM:REP 45->101|PF01047|4e-07|38.6|57/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 45->101|PF01047|2.1e-17|38.6|57/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 16->149|2bv6A1|3e-25|25.8|132/136|a.4.5.28| HM:SCP:REP 14->151|1jgsA_|7.1e-34|32.1|137/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 480 OP:NHOMOORG 313 OP:PATTERN -------------------------------------------121----3-3--------------- ----1---111-------------------------1-211---1-------1--1----------1---------------------1121-----------1-2------------------------1---1-122-----1----1---11-----------1111-------------11-------1-111111-2-1112-2----111-------11111111321-1----1--11--1-------1--------11----------111---1----21-----------------1---------------1-11---------3-3-111----12--1-----541311--1------1-1--211--------345---11121----------1---4--3-1424-45523323332321--1121----213----------1--111-------------------------------131-4222--2323-2----22-3------2131321--1121----533-11-11----------1-1---2---212-2---11----132211311-----11-1-----------1----------------1---1-1--133331211211111-111--1----------2113-1-1--1111111-1111111111111111111222-----1221222222212112--1---1------------------------1111--223----------------11111------1121--11-2121--11-----------221-----111-------------------1--2211----------1---------------------------1---1------ -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 90.6 SQ:SECSTR #########TcccHHHHcHHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHH###### DISOP:02AL 1-1,7-7,151-160| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccc //