[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49144.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->93 PF01527 * Transposase_8 4.5e-05 22.5 40/76  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49144.1 GT:GENE ABO49144.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 649390..649710 GB:FROM 649390 GB:TO 649710 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49144.1 GB:DB_XREF GI:134051173 LENGTH 106 SQ:AASEQ MKKRNQHRQALLRLLETELIMYPELKKKALKYPSFERIAHIQAIETALEVFCTNEVKREFVKLKFWGRRMKNHEIATQLEIPKEALPRWRKTLLTILAEKLNMDDL GT:EXON 1|1-106:0| HM:PFM:NREP 1 HM:PFM:REP 53->93|PF01527|4.5e-05|22.5|40/76|Transposase_8| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,105-107| PSIPRED cccHHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHHHHHHHHHHHHccccc //