[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49149.1
DDBJ      :             lipoate-protein ligase B
Swiss-Prot:LIPB_DESRM   RecName: Full=Octanoyltransferase;         EC=2.3.1.181;AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase;AltName: Full=Lipoyl/octanoyl transferase;AltName: Full=Lipoate-protein ligase B;

Homologs  Archaea  4/68 : Bacteria  610/915 : Eukaryota  156/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->213 2qhsA PDBj 8e-44 40.7 %
:RPS:PDB   2->224 2artA PDBj 6e-32 16.7 %
:RPS:SCOP  3->210 1w66A1  d.104.1.3 * 4e-46 37.9 %
:HMM:SCOP  1->214 1w66A1 d.104.1.3 * 6.5e-62 42.2 %
:HMM:PFM   58->164 PF03099 * BPL_LplA_LipB 1e-18 25.0 100/125  
:BLT:SWISS 1->228 LIPB_DESRM e-133 100.0 %
:PROS 75->90|PS01313|LIPB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49149.1 GT:GENE ABO49149.1 GT:PRODUCT lipoate-protein ligase B GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 654513..655199 GB:FROM 654513 GB:TO 655199 GB:DIRECTION + GB:PRODUCT lipoate-protein ligase B GB:NOTE TIGRFAM: lipoate-protein ligase B PFAM: biotin/lipoate A/B protein ligase KEGG: mxa:MXAN_4215 lipoate-protein ligase B GB:PROTEIN_ID ABO49149.1 GB:DB_XREF GI:134051178 InterPro:IPR000544 InterPro:IPR004143 LENGTH 228 SQ:AASEQ MKLFVAKLGEIDYQDALTMQEKLLLLRQQNKVEDIMLLLQHPPTLTLGTRENRYNILVPEVELKRQGVNIFKSNRGGDVTYHGPGQIVGYPIVDLNGHGKSIREYVHKIEETFIQLLKEEYDLTASRESKYHGVWLGNEKITAIGCAVKRWVTMHGFAFNVNTNLSHFNLINPCGITDRGVTSLQKIFGQPQDMEKVYKQVITYFSRVFDFEPEIIDDKKLNEIVGRE GT:EXON 1|1-228:0| SW:ID LIPB_DESRM SW:DE RecName: Full=Octanoyltransferase; EC=2.3.1.181;AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase;AltName: Full=Lipoyl/octanoyl transferase;AltName: Full=Lipoate-protein ligase B; SW:GN Name=lipB; OrderedLocusNames=Dred_0609; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->228|LIPB_DESRM|e-133|100.0|228/228| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 75->90|PS01313|LIPB|PDOC01017| BL:PDB:NREP 1 BL:PDB:REP 1->213|2qhsA|8e-44|40.7|209/210| RP:PDB:NREP 1 RP:PDB:REP 2->224|2artA|6e-32|16.7|215/247| HM:PFM:NREP 1 HM:PFM:REP 58->164|PF03099|1e-18|25.0|100/125|BPL_LplA_LipB| RP:SCP:NREP 1 RP:SCP:REP 3->210|1w66A1|4e-46|37.9|198/216|d.104.1.3| HM:SCP:REP 1->214|1w66A1|6.5e-62|42.2|204/0|d.104.1.3|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 833 OP:NHOMOORG 770 OP:PATTERN ------------------111----------------------------------------2------ 1111111111111111111-111111111111111111111111111111111111111111111111111-----------1--1111111-111-1111111111111------------------------1-111-1---1111111111111111111111111111111111111111111111-1----------------------------------------1------------------------------------------------------------------------------------------11---------------11-----------------1------1111---1--111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1--11-1111-111-11111111111-1----------------------11-111111111111111111111111111111111-1111111111111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111-111111-----------------------------------------------11 --------211-111111-1---1111111111-1111111--1-11111111-111----111111111111111111111111111-12111111-1112111--13-2-1121-111-1111111111--111---111121-1----1111-1-11121111111171-212222M2221222531332221111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 100.0 SQ:SECSTR EEEEEccccTTcHHHHHHHHHHHHHHccTTccccEEEEEccccEEEEcTTccHHHHccTTHHHHHHTcEEEEcccccccEEEcTTEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHTTcccEEccccTcTTcccccTTcEEEEEETTEEEEEEEEEccccHHHHHHHccccccTTTcccGGGGGTccccHHHHHHHHHHHHHHHHTEEEEcccHHHHHHHHHHH DISOP:02AL 227-229| PSIPRED cEEEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEEcccEEEEcccccHHHccccHHHHHcccccEEEEccccEEEEcccccEEEEEEEEHHHccccHHHHHHHHHHHHHHHHHHHcccccEEcccccEEEEcccEEEEEEEEEcccEEEEEEEEEcccccHHHHHccccccccccEEEHHHHHcccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHcccc //