[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49153.1
DDBJ      :             YheO domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  242/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:224 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->118 PF08348 * PAS_6 2e-25 57.4 %
:HMM:PFM   12->118 PF08348 * PAS_6 6.4e-34 45.8 107/118  
:HMM:PFM   194->214 PF02796 * HTH_7 0.00053 42.9 21/45  
:BLT:SWISS 18->214 Y575_HAEIN 8e-20 31.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49153.1 GT:GENE ABO49153.1 GT:PRODUCT YheO domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 658783..659457 GB:FROM 658783 GB:TO 659457 GB:DIRECTION + GB:PRODUCT YheO domain protein GB:NOTE PFAM: YheO domain protein KEGG: tte:TTE0922 hypothetical protein GB:PROTEIN_ID ABO49153.1 GB:DB_XREF GI:134051182 InterPro:IPR013559 LENGTH 224 SQ:AASEQ MTGQITETQHQLQILIPIATGLVQTFGKYCEVAVHDLRTPENSLIYVAGSITRREKGAPITNIVLEGVRKYGDSCPDLIGYKNVTKDGRILKSSTIFARNEEGKIIGCLCINYDISDLLTHKGHIEEFVGFGDKEQSSDSVEDFASDVTEVLENMIGQVIKNLTVPVANMQKEDKMQVVRELDLKGVFMIKGAVDKVAAVLGVSRYTVYNYLEEDRSNRTNNII GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 18->214|Y575_HAEIN|8e-20|31.8|192/221| RP:PFM:NREP 1 RP:PFM:REP 17->118|PF08348|2e-25|57.4|101/118|PAS_6| HM:PFM:NREP 2 HM:PFM:REP 12->118|PF08348|6.4e-34|45.8|107/118|PAS_6| HM:PFM:REP 194->214|PF02796|0.00053|42.9|21/45|HTH_7| OP:NHOMO 314 OP:NHOMOORG 243 OP:PATTERN -------------------------------------------------------------------- ----------1--------------1------------1------------------------12-1-2---------1--------------------------------------------------------------------------------------------------------1-------------------------1-111---------------------------------------2----------11----1--------1111-----------------1111111111111-----------11-1------------11----1---------1--2--111-111--1---------------1---------------------------1-----------------2-------------------------------------------------------------------11--2222321----22221-----221---1--111--11-1------------1---------------------11-111--------------------11--111112----------------22--------1-1111-111111-11-112-------------11111121111111111-1111111111111111111121221131112111111121221311111111-232323323222------------------22221111111111111111-------1111221212121----11---11-1-22231111132222-----------------1------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,131-143,218-225| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccEEEEEEcccccccccccccHHHHHHHHccccccccccccHHccccccEEEEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccc //