[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49157.1
DDBJ      :             pyridoxine biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  239/915 : Eukaryota  129/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:294 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->272 2nv2I PDBj e-107 74.2 %
:RPS:PDB   30->258 3barA PDBj 4e-23 11.3 %
:RPS:SCOP  18->271 1znnA1  c.1.2.6 * 7e-32 67.3 %
:HMM:SCOP  18->271 1znnA1 c.1.2.6 * 5e-69 35.8 %
:RPS:PFM   6->210 PF01680 * SOR_SNZ 1e-82 80.0 %
:HMM:PFM   5->212 PF01680 * SOR_SNZ 1.6e-116 78.4 208/209  
:HMM:PFM   174->255 PF05690 * ThiG 8.3e-10 31.6 79/247  
:BLT:SWISS 3->294 PDXS_HELMI e-134 84.6 %
:PROS 205->223|PS01235|PDXS_SNZ_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49157.1 GT:GENE ABO49157.1 GT:PRODUCT pyridoxine biosynthesis protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 662715..663599 GB:FROM 662715 GB:TO 663599 GB:DIRECTION + GB:PRODUCT pyridoxine biosynthesis protein GB:NOTE TIGRFAM: pyridoxine biosynthesis protein PFAM: Vitamin B6 biosynthesis protein KEGG: chy:CHY_2703 pyridoxine biosynthesis protein GB:PROTEIN_ID ABO49157.1 GB:DB_XREF GI:134051186 InterPro:IPR001852 LENGTH 294 SQ:AASEQ MAEKGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMALERVPADIRAAGGVARMADPNIILRIMEAVTIPVMAKARIGHFVEAQILEALGVDYIDESEVLTPADEVFHIDKHQFKVPYVCGARNLGEALRRIGEGAAMIRTKGEPGTGNVVEAVRHMRQVMSEIRMVHNMPKDELMTAAKEMGAPYDLVLQVHELGKLPVVNFAAGGIATPADAALMMQLGCDGIFVGSGIFKSNDPASRAKAIVAATTHYNDPKILAEISKDLGEAMPGMEISSIPTEHRMQERGW GT:EXON 1|1-294:0| BL:SWS:NREP 1 BL:SWS:REP 3->294|PDXS_HELMI|e-134|84.6|292/295| PROS 205->223|PS01235|PDXS_SNZ_1|PDOC00949| SEG 211->222|aaggiatpadaa| BL:PDB:NREP 1 BL:PDB:REP 2->272|2nv2I|e-107|74.2|271/271| RP:PDB:NREP 1 RP:PDB:REP 30->258|3barA|4e-23|11.3|212/323| RP:PFM:NREP 1 RP:PFM:REP 6->210|PF01680|1e-82|80.0|205/208|SOR_SNZ| HM:PFM:NREP 2 HM:PFM:REP 5->212|PF01680|1.6e-116|78.4|208/209|SOR_SNZ| HM:PFM:REP 174->255|PF05690|8.3e-10|31.6|79/247|ThiG| RP:SCP:NREP 1 RP:SCP:REP 18->271|1znnA1|7e-32|67.3|245/245|c.1.2.6| HM:SCP:REP 18->271|1znnA1|5e-69|35.8|254/0|c.1.2.6|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 483 OP:NHOMOORG 432 OP:PATTERN 1111111111111111-111111111111111-111111111111111111111111111-1111-11 1111111111111111111-1111111111111111112111111111111121211111111111111111111111-11-1---------1-------------------------------1-----------1111111111-------------------------------------1111111-11111111111111111111111111111111111111111111111111111111111111----------------------1-------------11111111111-----------------------1--111111-11---1-111------11-1111111311-1111111-11------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1-1---------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111---1-----------------------------111111111-----------------------------------------------1---------------------------11-1111111--- 11--111-1---211111111111111111111111111111111111111111111111111-111111-11116335211111111-12111111111111111-131-------------------------------------------------111-11--------1-1111A111115363141111121- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 100.0 SQ:SECSTR TEEccHHEcccccccccHHHHHTcHHHHHEGGGTcTTTHHHHHHHHHHHHHHHHHTccccccHHHcEEEEEEEcccHHHHHHHHHHHHTTccccEEEEccTTccGGGGGTHHcEETTTTEEcEEEEEEEccTTEEEcccTTTHHHHTTcEETTEEHHHHHHHHHHHHHHHTTTGGGTccEEEEEcTTcHHHHHHHHHHcTTccEEccccTTcccHHHHHHHHccccGGGEEEEEcHHHHTcccHHHHHHHHHHHHHHHTTTcHHHHHHcccccccccTccccccEEEEEccccH DISOP:02AL 1-6,8-8,279-279,294-295| PSIPRED cccccHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHcccEEEEEEHHccHHHHHccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccHHccccccccccccHHHcccccccccccHHHHHHHHHccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcHHcccHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccccEEEEcHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHcccc //