[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49162.1
DDBJ      :             protein of unknown function UPF0126
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  409/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:206 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->78 PF03458 * UPF0126 8e-11 44.0 %
:HMM:PFM   5->81 PF03458 * UPF0126 9.7e-30 45.5 77/81  
:HMM:PFM   90->167 PF03458 * UPF0126 1.9e-25 47.4 78/81  
:BLT:SWISS 3->190 YADS_AERPU 4e-25 36.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49162.1 GT:GENE ABO49162.1 GT:PRODUCT protein of unknown function UPF0126 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(668494..669114) GB:FROM 668494 GB:TO 669114 GB:DIRECTION - GB:PRODUCT protein of unknown function UPF0126 GB:NOTE PFAM: protein of unknown function UPF0126 KEGG: ppd:Ppro_2916 protein of unknown function UPF0126 GB:PROTEIN_ID ABO49162.1 GB:DB_XREF GI:134051191 InterPro:IPR005115 LENGTH 206 SQ:AASEQ MTLLSLLDMIGTFAFALTGALVAVRKEMDLYGILLLSFVTAIGGGTTRDLLLGNTPVFFLNQPSYFYISLLAGFCTFLFHKELFKINSIILILDALGLGLFVCVGVSIALSAHISFTGAVILGVVTGTVGGIIRDLLAGEIPTVLVKDFYALICVVGGILYVYLHHLNVPHDITLLVSASVIFFLRLAAIKLKWNFVKASRSSLLQ GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 3->190|YADS_AERPU|4e-25|36.4|184/210| TM:NTM 6 TM:REGION 13->35| TM:REGION 54->76| TM:REGION 90->112| TM:REGION 116->138| TM:REGION 143->165| TM:REGION 170->191| SEG 89->100|iilildalglgl| SEG 117->133|tgavilgvvtgtvggii| RP:PFM:NREP 1 RP:PFM:REP 4->78|PF03458|8e-11|44.0|75/81|UPF0126| HM:PFM:NREP 2 HM:PFM:REP 5->81|PF03458|9.7e-30|45.5|77/81|UPF0126| HM:PFM:REP 90->167|PF03458|1.9e-25|47.4|78/81|UPF0126| OP:NHOMO 587 OP:NHOMOORG 433 OP:PATTERN ------1111111111-1-1111---------------11111------------------------1 -1-----11111-11------------------111-111-------1----1---11----2---1121-1111111---11-111-1111-111---111111--111----------------------------------1--------------------------------------11------111222222222222222-111-12221111-11-------1-------------------------------------------1111111111--------------1111111111111-1----111-----1----------2--------------------1---------------------------1--1--1--1-11111111111---1------11-----11111111-11-1-111111111--------1------1-----------------------------------111112112121221222221111-1131------12-1--111-----11-----11---------1-11---------12----11111-111-212-----11-1111111-1-------1-111--221-1-212312222212222222222222--1-1--------22112212222222222-2222222222222222222222111112222222222222222222222221-222222212222---------1111--1111111-1-111112211111111121--11111221111111111---------1222222222222221111111111--------11----------------------------------------------------- ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------1----------------2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 202-204,206-207| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcc //