[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49166.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->73 PF10399 * UCR_Fe-S_N 0.0003 46.7 15/41  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49166.1 GT:GENE ABO49166.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(672894..673169) GB:FROM 672894 GB:TO 673169 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49166.1 GB:DB_XREF GI:134051195 LENGTH 91 SQ:AASEQ MTKFSVRDLQKGRPPLLGWSSLLFYLNRMDKRPRGLFSKRTSVTLKLNVISFFISKGTTSSVTVALAVVPLIDMSRILDSFTLFFNLFLNP GT:EXON 1|1-91:0| SEG 58->69|ttssvtvalavv| HM:PFM:NREP 1 HM:PFM:REP 59->73|PF10399|0.0003|46.7|15/41|UCR_Fe-S_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEHHHHHccccccccHHHHHHHHHHHcccHHHHHccccEEEEEEEEEEEEEcccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHccc //