[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49171.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.281.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->112 2c08A PDBj 2e-04 27.3 %
:RPS:SCOP  9->107 2pihA1  a.281.1.1 * 6e-08 18.2 %
:HMM:PFM   9->112 PF06133 * DUF964 2e-23 30.8 104/108  
:BLT:SWISS 10->100 Y916_BACC4 9e-11 26.4 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49171.1 GT:GENE ABO49171.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(676813..677202) GB:FROM 676813 GB:TO 677202 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: bce:BC0880 putative transcriptional regulator GB:PROTEIN_ID ABO49171.1 GB:DB_XREF GI:134051200 LENGTH 129 SQ:AASEQ MMTKIDAALDICIELGKVLSETEEYQNMKKAELALMHDQDARNLVEGLQKLQMDVQKKKLAGLPLTEEDKKQMQEAEAKAIENSIVKASFEAHEKFQAMMTLVSTKIRQGIRANEQPEISEDDVEDINA GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 10->100|Y916_BACC4|9e-11|26.4|91/118| COIL:NAA 15 COIL:NSEG 1 COIL:REGION 32->46| BL:PDB:NREP 1 BL:PDB:REP 14->112|2c08A|2e-04|27.3|99/196| HM:PFM:NREP 1 HM:PFM:REP 9->112|PF06133|2e-23|30.8|104/108|DUF964| RP:SCP:NREP 1 RP:SCP:REP 9->107|2pihA1|6e-08|18.2|99/123|a.281.1.1| OP:NHOMO 9 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11------------------------------------------------------------------------------------------------------------------------------------------------------23--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 76.7 SQ:SECSTR #############HHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH################# DISOP:02AL 1-4,60-76,117-118,123-124,128-130| PSIPRED ccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcc //