[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49184.1
DDBJ      :             acid phosphatase/vanadium-dependent haloperoxidase related
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  105/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->133 PF02681 * DUF212 9e-34 52.8 %
:HMM:PFM   9->145 PF02681 * DUF212 4.8e-57 55.5 137/141  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49184.1 GT:GENE ABO49184.1 GT:PRODUCT acid phosphatase/vanadium-dependent haloperoxidase related GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(695322..695771) GB:FROM 695322 GB:TO 695771 GB:DIRECTION - GB:PRODUCT acid phosphatase/vanadium-dependent haloperoxidase related GB:NOTE PFAM: acid phosphatase/vanadium-dependent haloperoxidase related KEGG: cya:CYA_0378 hypothetical protein GB:PROTEIN_ID ABO49184.1 GB:DB_XREF GI:134051213 InterPro:IPR003832 LENGTH 149 SQ:AASEQ MSEMYYWLWLNKILFAPLSAFLIAQIMKGILASIKSKKWHWDRFIEAGGMPSSHSAMVTALATASGLQYGWSSSLFTITAIFAIIVMYDAMGVRRAAGIHAKILNQMLEEMGRQDGQQNVKALRELIGHNPSEVVAGALLGVVMASVVF GT:EXON 1|1-149:0| TM:NTM 3 TM:REGION 12->34| TM:REGION 71->93| TM:REGION 128->149| SEG 134->148|vvagallgvvmasvv| RP:PFM:NREP 1 RP:PFM:REP 11->133|PF02681|9e-34|52.8|123/137|DUF212| HM:PFM:NREP 1 HM:PFM:REP 9->145|PF02681|4.8e-57|55.5|137/141|DUF212| OP:NHOMO 172 OP:NHOMOORG 120 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------1-----------11111111111111111111-11111111111111111111111-2111111111111111--1111-111--1111111111111--------------------------------------------111--------------------------------------------111-------------1--------1-------11-1--11-----1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1-111111-------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------223J333125536-54------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHc //