[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49188.1
DDBJ      :             Serine-type D-Ala-D-Ala carboxypeptidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  679/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.105.1e.3.1
:410 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->357 1nzuA PDBj 2e-40 36.2 %
:RPS:PDB   17->279 2bcfA PDBj 2e-28 31.2 %
:RPS:SCOP  24->269 1hd8A2  e.3.1.1 * 7e-66 37.9 %
:RPS:SCOP  272->361 1hd8A1  b.105.1.1 * 2e-15 28.9 %
:HMM:SCOP  1->272 1tvfA2 e.3.1.1 * 2.1e-71 41.7 %
:HMM:SCOP  264->361 1xp4A1 b.105.1.1 * 4e-19 38.5 %
:RPS:PFM   23->250 PF00768 * Peptidase_S11 1e-53 50.7 %
:RPS:PFM   272->361 PF07943 * PBP5_C 1e-11 37.8 %
:HMM:PFM   23->252 PF00768 * Peptidase_S11 4.9e-66 40.7 226/241  
:HMM:PFM   272->360 PF07943 * PBP5_C 8.6e-21 36.0 89/91  
:BLT:SWISS 28->353 DACB_BACSU 1e-51 37.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49188.1 GT:GENE ABO49188.1 GT:PRODUCT Serine-type D-Ala-D-Ala carboxypeptidase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 699586..700818 GB:FROM 699586 GB:TO 700818 GB:DIRECTION + GB:PRODUCT Serine-type D-Ala-D-Ala carboxypeptidase GB:NOTE PFAM: peptidase S11, D-alanyl-D-alanine carboxypeptidase 1; Penicillin-binding protein 5 domain protein KEGG: tte:TTE0925 D-alanyl-D-alanine carboxypeptidase GB:PROTEIN_ID ABO49188.1 GB:DB_XREF GI:134051217 InterPro:IPR001967 InterPro:IPR012907 LENGTH 410 SQ:AASEQ MYSRLINILIVLLLLTVTSQAWAGQPQITGETAVLLDAKSGAVLYGKEEHKRMYPASTTKVLTALVALEHARMTDRVTIGPNPSKAGGTSIWLQEGEQLAMQELLYALMLNSANDAGVAIAEHVAGSVGKFAAMSNERARELGANNTHFVNPHGMPNKDHYSTAYDLALIGQAALKNKDLRKILTTIHHEIPRADPEAQKYLFNHNKLLWSKTYGYKGATGLKTGYTVEAGQCIIASAERNGMELIAVVLRSEGFNLWTDAAKLLDYGFANFTNRQLVQGGKIMADVPVKYGKSHVKLLAQNDFYYTFPKEGTVDLHVITEPAEEAKAPVDKGQVLGAVVIQNGKEIVGKVPLVAQETVQRDWQAITKTYFKWILPPSLLLLWIRRRLYLKRKRQQRMARRQKYYNYPID GT:EXON 1|1-410:0| BL:SWS:NREP 1 BL:SWS:REP 28->353|DACB_BACSU|1e-51|37.7|313/382| TM:NTM 1 TM:REGION 1->21| SEG 5->15|linilivllll| SEG 373->403|wilppsllllwirrrlylkrkrqqrmarrqk| BL:PDB:NREP 1 BL:PDB:REP 24->357|1nzuA|2e-40|36.2|326/347| RP:PDB:NREP 1 RP:PDB:REP 17->279|2bcfA|2e-28|31.2|250/255| RP:PFM:NREP 2 RP:PFM:REP 23->250|PF00768|1e-53|50.7|215/235|Peptidase_S11| RP:PFM:REP 272->361|PF07943|1e-11|37.8|90/91|PBP5_C| HM:PFM:NREP 2 HM:PFM:REP 23->252|PF00768|4.9e-66|40.7|226/241|Peptidase_S11| HM:PFM:REP 272->360|PF07943|8.6e-21|36.0|89/91|PBP5_C| GO:PFM:NREP 4 GO:PFM GO:0006508|"GO:proteolysis"|PF00768|IPR001967| GO:PFM GO:0009002|"GO:serine-type D-Ala-D-Ala carboxypeptidase activity"|PF00768|IPR001967| GO:PFM GO:0006508|"GO:proteolysis"|PF07943|IPR012907| GO:PFM GO:0009002|"GO:serine-type D-Ala-D-Ala carboxypeptidase activity"|PF07943|IPR012907| RP:SCP:NREP 2 RP:SCP:REP 24->269|1hd8A2|7e-66|37.9|227/243|e.3.1.1| RP:SCP:REP 272->361|1hd8A1|2e-15|28.9|90/94|b.105.1.1| HM:SCP:REP 1->272|1tvfA2|2.1e-71|41.7|266/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| HM:SCP:REP 264->361|1xp4A1|4e-19|38.5|91/0|b.105.1.1|1/1|Penicillin-binding protein associated domain| OP:NHOMO 1636 OP:NHOMOORG 683 OP:PATTERN -------------------------------------------------------------------- 1--13111111-1-22222-231123222222333311111111-------1--------22--111544--------11211-1-------------------------111111111111111111-11111-1---------4---------------------------------------------4338888899889889984444338993334422222222441--------------21-2111411111111222211121-1-1111112222211111111111112222222222222211111111334344444444443444554444545225342366554234333333-12-1-111123333333333333333244444343444-333333334422444455455544332222222222222222222222222232211111111----11111111111111111111211222233333332444433325555343322122112222222222242233232222222222221122221-----1-22-111-1-1---1--------121--------------------1---33332121111112222222122221211211--11211------44334444444434443-44544444444444444434443322244434444444242345234322321333333333333--11111111111212211112-11111111-13333333222212222222222222222211111111111114333333322222111111111111111-------1111111111------------------------------------212 --------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 341 STR:RPRED 83.2 SQ:SECSTR ################cccTTccccccccccEEEEEETTTcEEEEEEcTTcccccGGGHHHHHHHHHHHHccTTcEEEccTGGGccccccccccTTcEEEHHHHHHHHHHcccHHHHHHHHHTTcHHTccHHHHHHHHHHHHTcTTcccccccccTTccccccHHHHHHHHHHHHcHHHHHHHHccEEEccccEEEEEEcEEEcccTHHccHHHHcTTEEEEEEEEETTTEEEEEEEEEETTEEEEEEEEcTTcccHHHHHHHHHHHHHHccTTcccEEcTTTTTTHHHHHHHHHHHHHHHHcTTTTcccccccHHHTTHHcTTcEEEEEETccccEEEEccTccEEEEEEEEEccc##################################################### DISOP:02AL 1-1,392-403,407-407,409-411| PSIPRED cHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEcHHHHcccccEEEEccccEEEHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEEEccccccccccEEcHHHHHHHHHHHHHcccHHHHHcEEEEEEEccccccEEEEEEEEccccccccccccEEEEEEEcccccccEEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEccccEEEEEEcccccccEEEEEcccEEEEEEcccccEEEEEEEccccccccHHcccEEEEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //