[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49193.1
DDBJ      :             MOSC domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  70/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.58.1
:139 amino acids
:PSIPRED
:HMM:SCOP  1->140 1o65A_ b.58.1.2 * 2.4e-22 26.4 %
:HMM:PFM   81->102 PF07831 * PYNP_C 0.00064 40.9 22/75  
:BLT:SWISS 14->97 YFLK_BACSU 8e-05 26.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49193.1 GT:GENE ABO49193.1 GT:PRODUCT MOSC domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 706529..706948 GB:FROM 706529 GB:TO 706948 GB:DIRECTION + GB:PRODUCT MOSC domain protein GB:NOTE KEGG: chy:CHY_0804 MOSC domain protein GB:PROTEIN_ID ABO49193.1 GB:DB_XREF GI:134051222 LENGTH 139 SQ:AASEQ MGEVLAINVSAVRGIEKNSINEVMVVEGWGLEGDAHGGDWSKQVSIFPVEAMEKVPLHKKQEVLSGGYTENFTIAGINPDQIKVGTKVKLGEAIIEIFHVGKEIFKESGRPYIVSREGRFGKVIKGGLVKVGDKIIVEA GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 14->97|YFLK_BACSU|8e-05|26.5|83/221| SEG 121->137|gkvikgglvkvgdkiiv| HM:PFM:NREP 1 HM:PFM:REP 81->102|PF07831|0.00064|40.9|22/75|PYNP_C| HM:SCP:REP 1->140|1o65A_|2.4e-22|26.4|140/233|b.58.1.2|1/1|PK beta-barrel domain-like| OP:NHOMO 81 OP:NHOMOORG 70 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111-------------------------------------------111111111-----------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------11212111111111111---1111--11--11111-221-11121-1----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11--111-----2122212-1------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12---1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEccccccEEEEcccEEEEccccccccccccccHHcEEEEEHHHHHHHHHHHccccccccccccEEEEcccHHHcccccEEEEccEEEEEcccccccccccccccccccccEEEEEEcccEEccccEEEEEc //