[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49197.1
DDBJ      :             Cobyrinic acid a,c-diamide synthase
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:282 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   68->113 1clfA PDBj 4e-06 39.1 %
:BLT:PDB   147->276 1ionA PDBj 2e-06 36.1 %
:RPS:PDB   1->280 1cp2A PDBj 1e-21 16.1 %
:RPS:SCOP  1->280 1cp2A  c.37.1.10 * 8e-22 15.8 %
:HMM:SCOP  1->282 1ionA_ c.37.1.10 * 3.4e-35 32.6 %
:RPS:PFM   3->49 PF09140 * MipZ 1e-07 46.8 %
:HMM:PFM   3->238 PF01656 * CbiA 1.8e-28 30.2 159/194  
:HMM:PFM   213->279 PF00142 * Fer4_NifH 4.8e-05 20.0 65/273  
:BLT:SWISS 3->44 NUBP2_RAT 6e-05 45.2 %
:BLT:SWISS 19->278 Y578_METJA 4e-28 33.7 %
:PROS 99->110|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49197.1 GT:GENE ABO49197.1 GT:PRODUCT Cobyrinic acid a,c-diamide synthase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(709110..709958) GB:FROM 709110 GB:TO 709958 GB:DIRECTION - GB:PRODUCT Cobyrinic acid a,c-diamide synthase GB:NOTE PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain protein; Cobyrinic acid a,c-diamide synthase KEGG: mbu:Mbur_0617 cobyrinic acid a,c-diamide synthase GB:PROTEIN_ID ABO49197.1 GB:DB_XREF GI:134051226 InterPro:IPR001450 InterPro:IPR002586 LENGTH 282 SQ:AASEQ MKISVASGKGGTGKTLVATSLALSLIKNNPSVQLLDCDVEEPNVHLFLDQEPINETTVSLPIPKINEDLCQHCGKCTEICRFNAITLLKDTILIFPDVCHSCSACWHFCPTGALEPSPREVGTVQISQSGKLKLITGRLNLGVHASPPVIKAVRGAIDTDTVTIIDGPPGSSCPVMAAVEETDYCILVTEPTPFGLNDLSLAVEMLKVLNVPCGVIINRDVPGNHLIDDYCQEKGLPILLRIPLDTEIARAYAKGIPLVKSSPVWTEKFIDLYQQVTQEVTK GT:EXON 1|1-282:0| BL:SWS:NREP 2 BL:SWS:REP 3->44|NUBP2_RAT|6e-05|45.2|42/271| BL:SWS:REP 19->278|Y578_METJA|4e-28|33.7|246/276| PROS 99->110|PS00198|4FE4S_FER_1|PDOC00176| BL:PDB:NREP 2 BL:PDB:REP 68->113|1clfA|4e-06|39.1|46/55| BL:PDB:REP 147->276|1ionA|2e-06|36.1|119/234| RP:PDB:NREP 1 RP:PDB:REP 1->280|1cp2A|1e-21|16.1|236/269| RP:PFM:NREP 1 RP:PFM:REP 3->49|PF09140|1e-07|46.8|47/62|MipZ| HM:PFM:NREP 2 HM:PFM:REP 3->238|PF01656|1.8e-28|30.2|159/194|CbiA| HM:PFM:REP 213->279|PF00142|4.8e-05|20.0|65/273|Fer4_NifH| RP:SCP:NREP 1 RP:SCP:REP 1->280|1cp2A|8e-22|15.8|234/269|c.37.1.10| HM:SCP:REP 1->282|1ionA_|3.4e-35|32.6|227/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 156 OP:NHOMOORG 76 OP:PATTERN ----1-----------2------2----------222-2222---2222322222222222---1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---2222222-2---442-----------2122242221-2222-----1----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------322222222222-----2---42------22------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--22-2----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcTTccHHHHHHHHHHHHHTTTccEEEEEEcTTccccHHHHTccccccHHHHHHHHccTTcccHHccTTcccHcHHHHHHHHGGGccHHHHcEEcGGGcEEEEcccccTTTcccTTHHHHHHHHHHHHcccHHHHHHHHHHHHHHTTcccTTccEEEEEEEcccccTHHHHTTcccEEEEEEcccHHHHHHHHHHHHHHHHHcTTEEEEEEcccccccHHHHHHHHHTccEEEEEcccHHHHHHHHTTccHHHHcTHHHHHHHHHHHHHHHccHH PSIPRED cEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEccccccccEEEcccccccccccccEEEEccccccccHHHHHHcccccEEEEcccEEEEHHHHHHHHHHHHHcccccccccccccccEEEEcccccccEEccccccHHHHHHHHHHHHHHHHHccEEEEcccccccHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHcccEEEEEcccHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHcc //