[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49203.1
DDBJ      :             Patatin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  378/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.19.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   25->119 3deaA PDBj 6e-04 14.9 %
:RPS:SCOP  4->214 1oxwA  c.19.1.3 * 3e-33 20.0 %
:HMM:SCOP  1->296 1oxwA_ c.19.1.3 * 1e-51 37.0 %
:RPS:PFM   7->205 PF01734 * Patatin 4e-19 37.7 %
:HMM:PFM   7->206 PF01734 * Patatin 1.3e-32 28.5 193/204  
:HMM:PFM   206->264 PF04123 * DUF373 0.00068 32.2 59/344  
:BLT:SWISS 4->51 PLPL_ASPTN 4e-06 37.5 %
:BLT:SWISS 22->293 YLBK_BACSU 2e-25 31.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49203.1 GT:GENE ABO49203.1 GT:PRODUCT Patatin GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 716138..717037 GB:FROM 716138 GB:TO 717037 GB:DIRECTION + GB:PRODUCT Patatin GB:NOTE PFAM: Patatin KEGG: chy:CHY_2088 patatin family protein GB:PROTEIN_ID ABO49203.1 GB:DB_XREF GI:134051232 InterPro:IPR002641 LENGTH 299 SQ:AASEQ MSKKIGLALGGGFVRGAAHVGVLKVLEENNIKPHMVAGTSAGSMIASLYASGWSVSELENMVCALKPGVFIDEIAAVENFFIMTLKLFIDALRLPCPFRSPLGLMKGVKLTRFIRSMLGKKNFEGSPLQLAITSVDIASGKKVIFVSRQDRMKLTAKEDQVFISGVPVWEAVRASTAVPGIYEPKKIHEYLLVDGGLRENVPALVLKRLGADVVIAVDLGNDGHEHTVPRNILEMMEQTLDIIRADALEYVLDGNADVRIRPLLKGIGAWDFYKIPHIISQGEKAARELLPEIIRICKL GT:EXON 1|1-299:0| BL:SWS:NREP 2 BL:SWS:REP 4->51|PLPL_ASPTN|4e-06|37.5|48/715| BL:SWS:REP 22->293|YLBK_BACSU|2e-25|31.6|228/260| RP:PDB:NREP 1 RP:PDB:REP 25->119|3deaA|6e-04|14.9|94/185| RP:PFM:NREP 1 RP:PFM:REP 7->205|PF01734|4e-19|37.7|175/182|Patatin| HM:PFM:NREP 2 HM:PFM:REP 7->206|PF01734|1.3e-32|28.5|193/204|Patatin| HM:PFM:REP 206->264|PF04123|0.00068|32.2|59/344|DUF373| GO:PFM:NREP 1 GO:PFM GO:0006629|"GO:lipid metabolic process"|PF01734|IPR002641| RP:SCP:NREP 1 RP:SCP:REP 4->214|1oxwA|3e-33|20.0|195/360|c.19.1.3| HM:SCP:REP 1->296|1oxwA_|1e-51|37.0|262/0|c.19.1.3|1/1|FabD/lysophospholipase-like| OP:NHOMO 505 OP:NHOMOORG 386 OP:PATTERN -------------------------------------------------------------------- -21------------1111-11--211111111111-----------------------------------------------1-1115422-311---1211121---2--------------122122222212-----111----------1-----------------------------1-1111121111111121111111112--21111111----------1-------------------------------------------------------------------------------------------1-----------1-1-------------2--1-11-1-21121--11111--------------11112-1----11111111111---1--2-2111-1---11-111----11--------------------------1----------------------------------------222222222212222222212322333411122211112221--1221---221111111--1112--2----1--------1-1---1-1121-1-1--------------------1-1-12122-12-211-11111121111111112121---1121------1-21-1-1111111111-111111111111111111111111---111111111111111111111111--1--------------------1111-111----------------2222222---1111111111111112------------2-223111111121111111111111111----442233--------11---------------------------12-1-------- ----------------------------------------------------------------------1-----------------------------------------1----------------------------------------2----1---2----------11--------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 31.4 SQ:SECSTR ########################HHHHcTTcEEEEEEETHHHHHHHHHHHTccHHHHEEEEEEEccTTTTTTTTccTTccGGGEEEEccTTcGGGGccccHHHHHT#HHHHHHHHHHc#################################################################################################################################################################################### DISOP:02AL 1-1| PSIPRED cccEEEEEEccHHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHccccHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccHHHccccEEEEEEEcccccEEEEEccccccccccHHHHcccccccHHHHHHHHHccccccccEEEccEEEEEEEcccccHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccc //