[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49225.1
DDBJ      :             RNA polymerase, sigma 28 subunit, FliA/WhiG family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  814/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:241 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->124 1sigA PDBj 2e-12 40.5 %
:RPS:PDB   14->223 3dxjF PDBj 2e-16 28.6 %
:RPS:SCOP  39->129 1sigA  a.177.1.1 * 9e-22 37.4 %
:RPS:SCOP  179->223 1ku3A  a.4.13.2 * 4e-10 40.0 %
:HMM:SCOP  14->134 1ku2A2 a.177.1.1 * 1.4e-34 39.7 %
:HMM:SCOP  144->239 1iw7F2 a.4.13.2 * 9.7e-20 31.2 %
:RPS:PFM   64->130 PF04542 * Sigma70_r2 7e-10 43.3 %
:HMM:PFM   64->133 PF04542 * Sigma70_r2 2.1e-20 38.6 70/71  
:HMM:PFM   182->235 PF04545 * Sigma70_r4 4.4e-18 44.0 50/50  
:BLT:SWISS 1->223 RPSE_BACSU 2e-84 74.3 %
:PROS 88->101|PS00715|SIGMA70_1
:PROS 207->233|PS00716|SIGMA70_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49225.1 GT:GENE ABO49225.1 GT:PRODUCT RNA polymerase, sigma 28 subunit, FliA/WhiG family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 740503..741228 GB:FROM 740503 GB:TO 741228 GB:DIRECTION + GB:PRODUCT RNA polymerase, sigma 28 subunit, FliA/WhiG family GB:NOTE PFAM: sigma-70 region 2 domain protein; sigma-70 region 4 domain protein KEGG: mta:Moth_0852 sigma 28 (flagella/sporulation) GB:PROTEIN_ID ABO49225.1 GB:DB_XREF GI:134051254 InterPro:IPR000943 InterPro:IPR007627 InterPro:IPR007630 LENGTH 241 SQ:AASEQ MKNVWHFKILIRIYLARVIHWLGYQQEVYYVGSSEALPPPLSIDEEIDLIERLGDGDLKVKNVLIERNLRLVVYIARKFENTGIGIEDLVSIGTIGLIKAVNTFDPHKKIKLATYASRCIENEILMHLRRNNKTRSEVSFDEPLNIDWDGNELLLSDVLGTENDIIYKNIEEEVDKKLLHQALLKLSGRERRIMELRFGLNNGSEKTQKEVADMLGISQSYISRLEKRIIKRLKKEIHRME GT:EXON 1|1-241:0| BL:SWS:NREP 1 BL:SWS:REP 1->223|RPSE_BACSU|2e-84|74.3|214/239| PROS 88->101|PS00715|SIGMA70_1|PDOC00592| PROS 207->233|PS00716|SIGMA70_2|PDOC00592| SEG 224->237|rlekriikrlkkei| BL:PDB:NREP 1 BL:PDB:REP 41->124|1sigA|2e-12|40.5|84/305| RP:PDB:NREP 1 RP:PDB:REP 14->223|3dxjF|2e-16|28.6|210/349| RP:PFM:NREP 1 RP:PFM:REP 64->130|PF04542|7e-10|43.3|67/70|Sigma70_r2| HM:PFM:NREP 2 HM:PFM:REP 64->133|PF04542|2.1e-20|38.6|70/71|Sigma70_r2| HM:PFM:REP 182->235|PF04545|4.4e-18|44.0|50/50|Sigma70_r4| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| RP:SCP:NREP 2 RP:SCP:REP 39->129|1sigA|9e-22|37.4|91/305|a.177.1.1| RP:SCP:REP 179->223|1ku3A|4e-10|40.0|45/61|a.4.13.2| HM:SCP:REP 14->134|1ku2A2|1.4e-34|39.7|121/0|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 144->239|1iw7F2|9.7e-20|31.2|96/105|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 1812 OP:NHOMOORG 828 OP:PATTERN -------------------------------------------------------------------- 11111111111-1111111-11111111111111111---3121------1---------111-3125493-------1--1722132111111111--11111221114111111111111111---------1-1221----13E364224334443432333334562143133342133-1---111655555555555555555554454555555451111111166111111111111111111111112112111111111111111111111111111111111111111111111111111111--111---159656675567668546665555655-15546555476557455565111322111111111111111111111111111111111-2212212211-12---22-2221-111121111111111222222221222223311111111----1111111111111111-111111111112222221111133231111112331112--1111221122212133322222211111112233331-121221122222132433222255553212-----------1-1111111-1---333332423333333333333333333333331-2533222122232223333331333333-3333323233333333333333223332333333333333333232332332222222222222222223333333332223322222222222222222222222223333333322233333232222222222144443333343333222222222211112222--11112222222222-----1-111111-11111---11111131111111231 -------1----------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1B111--1--1-1-221---2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 87.1 SQ:SECSTR #############ccTTcccccccccccTTTHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcTTcccccGGGTccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHTTTTccTTcHHHHHHHTTcccHHHHH################## DISOP:02AL 1-2,239-242| PSIPRED cccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcc //