[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49233.1
DDBJ      :             ribonucleoside-triphosphate reductase class III activase subunit
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  333/915 : Eukaryota  1/199 : Viruses  6/175   --->[See Alignment]
c.1.28d.81.1
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->163 3cb8A PDBj 6e-09 27.9 %
:RPS:PDB   2->110 3c8fA PDBj 3e-07 23.9 %
:RPS:SCOP  77->143 1e5lA2  d.81.1.2 * 8e-05 14.9 %
:HMM:SCOP  19->105 1tv8A_ c.1.28.3 * 1.5e-10 22.1 %
:HMM:PFM   24->103 PF04055 * Radical_SAM 1e-13 30.0 80/166  
:BLT:SWISS 6->41 PFLC_ECOLI 5e-06 50.0 %
:BLT:SWISS 16->148 NRDG_BPT4 3e-23 37.1 %
:PROS 18->39|PS01087|RADICAL_ACTIVATING
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49233.1 GT:GENE ABO49233.1 GT:PRODUCT ribonucleoside-triphosphate reductase class III activase subunit GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 749757..750263 GB:FROM 749757 GB:TO 750263 GB:DIRECTION + GB:PRODUCT ribonucleoside-triphosphate reductase class III activase subunit GB:NOTE KEGG: dsy:DSY0396 hypothetical protein TIGRFAM: anaerobic ribonucleoside-triphosphate reductase activating protein PFAM: Radical SAM domain protein GB:PROTEIN_ID ABO49233.1 GB:DB_XREF GI:134051262 InterPro:IPR001989 InterPro:IPR007197 InterPro:IPR012837 LENGTH 168 SQ:AASEQ MSLTLRLGGITANSVVDGPGLRIVVFLQGCPRYCPGCHNEELLEPEGGREITTEEAIEEIKATISPLTQGITFSGGDPLMQPQALQFLVKRVRQEFPRLDIWVYTGYRYEEVKDLPVLEQVDVLVDGPFLQEQRDLDLVFRGSGNQRLIDVPKTRQTGQVVEWQQPVW GT:EXON 1|1-168:0| BL:SWS:NREP 2 BL:SWS:REP 6->41|PFLC_ECOLI|5e-06|50.0|36/292| BL:SWS:REP 16->148|NRDG_BPT4|3e-23|37.1|132/156| PROS 18->39|PS01087|RADICAL_ACTIVATING|PDOC00834| SEG 50->64|eitteeaieeikati| BL:PDB:NREP 1 BL:PDB:REP 6->163|3cb8A|6e-09|27.9|154/244| RP:PDB:NREP 1 RP:PDB:REP 2->110|3c8fA|3e-07|23.9|109/245| HM:PFM:NREP 1 HM:PFM:REP 24->103|PF04055|1e-13|30.0|80/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 77->143|1e5lA2|8e-05|14.9|67/267|d.81.1.2| HM:SCP:REP 19->105|1tv8A_|1.5e-10|22.1|86/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 380 OP:NHOMOORG 342 OP:PATTERN ---------------------------------11--------------------------------- ----1--1---------------------------------2------------1------1-1-------11111111112------1111-111--------------------------------------------------21-1--121----------1-1111-------------------1-------11111111111--22--111-----21111111--111111111111111111-111-11111111111111111111111111111111111111111111111111111111111111111111-11333333232322111211121-121111-11212-111------14---------------------1--1-----------------------------------------------------------------1-------------------------------------------1-11---------------------------------1-1-----1---1----------------------1-------------------1-------------1----------------111-------211111111111-1111-11-------------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1-----------------111-1111-111-------------111-1---------------------11111111112211----------------------------------1------------------1------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ---1---------------1----------------11-1----------------------------------------------------------------------------------------------------------------------------1---------- STR:NPRED 162 STR:RPRED 96.4 SQ:SECSTR #cccEEEEEEEEEEcTTcccEEEEEEEcccccccTTcccGGGccTTccEEEcHHHHHHHHGGGHHcTTcEEEEEEccGGGGHHHHHHHHHHHHTTTccEEEEEcccccccHHHHHHTccEEEEEcTTccHHHHHHHHHccccccHHHHHHHHHHHHTTTccEE##### DISOP:02AL 1-2| PSIPRED ccEEEEEccEEEEEccccccEEEEEEEccccccccccccHHHHcccccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHcEEEccHHccccccccccccccccHHHHHHHHHHHHcccEEEEEccc //