[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49234.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.248.1
:65 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->61 2k5eA PDBj 1e-11 44.1 %
:HMM:SCOP  1->65 2fi0A1 a.248.1.1 * 5.2e-17 43.1 %
:RPS:PFM   4->57 PF08984 * DUF1858 6e-14 53.7 %
:HMM:PFM   4->57 PF08984 * DUF1858 6.3e-18 31.5 54/59  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49234.1 GT:GENE ABO49234.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 750527..750724 GB:FROM 750527 GB:TO 750724 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: cno:NT01CX_0906 hypothetical protein GB:PROTEIN_ID ABO49234.1 GB:DB_XREF GI:134051263 LENGTH 65 SQ:AASEQ MSKITRDMTMGYIVKEFPQTVEVFQRYGMGCLSCPTAQLESLEKGAMLHGLDVQELLEELNKVVQ GT:EXON 1|1-65:0| BL:PDB:NREP 1 BL:PDB:REP 3->61|2k5eA|1e-11|44.1|59/73| RP:PFM:NREP 1 RP:PFM:REP 4->57|PF08984|6e-14|53.7|54/54|DUF1858| HM:PFM:NREP 1 HM:PFM:REP 4->57|PF08984|6.3e-18|31.5|54/59|DUF1858| HM:SCP:REP 1->65|2fi0A1|5.2e-17|43.1|65/0|a.248.1.1|1/1|SP0561-like| OP:NHOMO 57 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1212211111112122-1111111--1----1-22-1-1-112---1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121212212-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 92.3 SQ:SECSTR ##cccccccHHHHHHHcTHHHHHHHHTTGGGGGTTTGGGccHHHHHHHTTccHHHHHHHHHH### DISOP:02AL 1-1,65-66| PSIPRED ccEEEHHHHHHHHHHHccHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHc //