[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49242.1
DDBJ      :             cytochrome c assembly protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  428/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
:283 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   69->275 PF01578 * Cytochrom_C_asm 1e-37 49.7 %
:HMM:PFM   68->280 PF01578 * Cytochrom_C_asm 1.8e-55 41.0 205/214  
:HMM:PFM   11->84 PF04544 * Herpes_UL20 0.00018 28.4 74/179  
:BLT:SWISS 57->282 CCSA_SYNR3 2e-51 46.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49242.1 GT:GENE ABO49242.1 GT:PRODUCT cytochrome c assembly protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 756694..757545 GB:FROM 756694 GB:TO 757545 GB:DIRECTION + GB:PRODUCT cytochrome c assembly protein GB:NOTE PFAM: cytochrome c assembly protein KEGG: mta:Moth_2200 cytochrome c assembly protein GB:PROTEIN_ID ABO49242.1 GB:DB_XREF GI:134051271 InterPro:IPR002541 InterPro:IPR003557 LENGTH 283 SQ:AASEQ MNSIIEQLIFNSTLCLYALGALILLAYTVTEKTRLVNWAVFAVWTGFLAHTAGLVMRSIHVGRLPFTNMYEFILFFAWGVTLAYLFTHRKQPLPLLGTVVVPMTVMLMAAASMMNGAVRPLMPALQSYWLHSHVATAVLAYGAFGVSFGVGVLYLIRDAQPMSLSSTEIGNTAVIRGVPMLPSIETLDKLLYRVIAFGFVFLTLVLITGAVWAEQAWGTWWSWDPKETWALITWLIYAIFLHGRFTRGWQGRRSAWLAILGFAAVIFTLFGVTWLMPGMHSYS GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 57->282|CCSA_SYNR3|2e-51|46.2|223/311| TM:NTM 8 TM:REGION 6->28| TM:REGION 36->58| TM:REGION 64->85| TM:REGION 92->114| TM:REGION 134->156| TM:REGION 191->213| TM:REGION 230->251| TM:REGION 255->277| SEG 14->26|lclyalgalilla| RP:PFM:NREP 1 RP:PFM:REP 69->275|PF01578|1e-37|49.7|197/212|Cytochrom_C_asm| HM:PFM:NREP 2 HM:PFM:REP 68->280|PF01578|1.8e-55|41.0|205/214|Cytochrom_C_asm| HM:PFM:REP 11->84|PF04544|0.00018|28.4|74/179|Herpes_UL20| GO:PFM:NREP 3 GO:PFM GO:0006461|"GO:protein complex assembly"|PF01578|IPR002541| GO:PFM GO:0008535|"GO:respiratory chain complex IV assembly"|PF01578|IPR002541| GO:PFM GO:0016020|"GO:membrane"|PF01578|IPR002541| OP:NHOMO 613 OP:NHOMOORG 441 OP:PATTERN ---1-------------------1--------------------------2-2--------------- 132-111111111111111-131111111111212211111111211111112141111111211111111------------111222241-211---1211121------------------121112111122---------12111111111111111111111111111111111111---------111111111111111112211111111112111------111------------------------------------------------------------------------------------------11-------------------------2--1-11-1-112-1-------121111---11--------------------------11-11-1-1------------------1----1111--1-------------------------------------------------1-22222222222211112211111111252111112111221222211211111122112222222111-1-12222222222222255536662244341-222211111221211111111113111112---11----------------------------2-1------11--1-11111111111-111111111111111111111122-------------------21111111--222222222222-------------1---1----1-1----111-111111--1--1-----11--------1----------2---1------------------------111-111111----------------------------------------------132 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1811---11-5--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,282-284| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //