[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49251.1
DDBJ      :             alanine racemase domain protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  797/915 : Eukaryota  165/199 : Viruses  0/175   --->[See Alignment]
c.1.6
:226 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->223 1w8gA PDBj 4e-29 37.2 %
:RPS:PDB   3->221 3cpgA PDBj 1e-36 34.7 %
:RPS:SCOP  3->222 1b54A  c.1.6.2 * 4e-26 28.1 %
:HMM:SCOP  1->222 1ct5A_ c.1.6.2 * 2.6e-76 49.5 %
:RPS:PFM   6->224 PF01168 * Ala_racemase_N 1e-23 36.5 %
:HMM:PFM   6->224 PF01168 * Ala_racemase_N 8.9e-39 32.4 188/214  
:BLT:SWISS 1->225 Y274_AQUAE 6e-55 47.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49251.1 GT:GENE ABO49251.1 GT:PRODUCT alanine racemase domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 766609..767289 GB:FROM 766609 GB:TO 767289 GB:DIRECTION + GB:PRODUCT alanine racemase domain protein GB:NOTE PFAM: alanine racemase domain protein KEGG: mta:Moth_0858 protein of unknown function UPF0001 GB:PROTEIN_ID ABO49251.1 GB:DB_XREF GI:134051280 InterPro:IPR001608 InterPro:IPR011078 LENGTH 226 SQ:AASEQ MSIAENISVIKGKIIESALRAGRDPASVRLIAVTKTVSADKARECIDAGVGDLGENRVQEFRNKLPEVPGARWHLIGHLQTNKVKYITGEVTLLHSLDRWSLAEEIHKRSLEAGIVTPALVQVNVAGEETKFGMAVQEVRDFITEVAGLSGISIQGLMTIAPLVENPEEVRPVFRQLRELATDLQEVPGVKMEQLSMGMTNDYQVAIEEGATLVRIGTAIFGSRRL GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 1->225|Y274_AQUAE|6e-55|47.6|225/228| BL:PDB:NREP 1 BL:PDB:REP 3->223|1w8gA|4e-29|37.2|215/226| RP:PDB:NREP 1 RP:PDB:REP 3->221|3cpgA|1e-36|34.7|216/247| RP:PFM:NREP 1 RP:PFM:REP 6->224|PF01168|1e-23|36.5|208/211|Ala_racemase_N| HM:PFM:NREP 1 HM:PFM:REP 6->224|PF01168|8.9e-39|32.4|188/214|Ala_racemase_N| RP:SCP:NREP 1 RP:SCP:REP 3->222|1b54A|4e-26|28.1|210/230|c.1.6.2| HM:SCP:REP 1->222|1ct5A_|2.6e-76|49.5|218/0|c.1.6.2|1/1|PLP-binding barrel| OP:NHOMO 1032 OP:NHOMOORG 966 OP:PATTERN -------------------------------------------------1111--------------- 1111111111111111111-1111121111111---1111111-111111111111-1--111111111111111111111111111111111111---11211121211--------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------11--------1111111111111111111111111111111111111111111111111111111111111121111111111-11111111111111111111-11111111111111111111112121111111111112-1111111111111111111111111111111111111111111111111111112-----------------------------111111222121111111111111111111111111112-111211111211111121211111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111--1111111-11111211211111111111-11111111111111111111112211111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111221111111111111111111111--------1-1-------------------------1111111111111 --11111-3111-111111111111--------1111111-11111111111-1111-1111111111-1111111111-11111111-12111111-11-1-111-12-12111121-1-11-21111241-111111121111-1-1111-2-111134211111112-11311-11F1111121-11311111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 224 STR:RPRED 99.1 SQ:SECSTR ##HHHHHHHHHHHHHHHHHHTTccTTccEEEEEcTTccHHHHHHHHHTTccEEEEccHHHHHHHHHTcEEEcEEEcccccGGGHHHHTTTccEEEEEccHHHHHHHHHHHHHHTccEEEEEEccccccTTcccccGGGHHHHHHHHHTcTTEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccTTcTTccEEEcTTTHHHHHTTccEEEEcTTTccccTT PSIPRED ccHHHHHHHHHHHHHHHHHHccccHHHcEEEEEEccccHHHHHHHHHccccEEEccHHHHHHHHHHHcccccEEEEccccHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEccccHHHHHHHHccccEEEEcHHHcccccc //