[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49256.1
DDBJ      :             protein of unknown function DUF167
Swiss-Prot:Y717_DESRM   RecName: Full=UPF0235 protein Dred_0717;

Homologs  Archaea  5/68 : Bacteria  194/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.206.1
:94 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->76 1n91A PDBj 5e-14 43.4 %
:RPS:SCOP  4->81 1n91A  d.206.1.1 * 5e-23 43.6 %
:HMM:SCOP  1->95 1n91A_ d.206.1.1 * 5.4e-24 41.1 %
:RPS:PFM   7->83 PF02594 * DUF167 3e-16 50.6 %
:HMM:PFM   8->82 PF02594 * DUF167 2e-28 48.0 75/78  
:BLT:SWISS 1->94 Y717_DESRM 2e-50 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49256.1 GT:GENE ABO49256.1 GT:PRODUCT protein of unknown function DUF167 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 769567..769851 GB:FROM 769567 GB:TO 769851 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF167 GB:NOTE PFAM: protein of unknown function DUF167 KEGG: aba:Acid345_4205 protein of unknown function DUF167 GB:PROTEIN_ID ABO49256.1 GB:DB_XREF GI:134051285 InterPro:IPR003746 InterPro:IPR005228 LENGTH 94 SQ:AASEQ MFDIKEDQNGVVVKVRVQPRASKNSLAGEMEGALKVRLTAPPVDGAANEACCKFFGELFGVAKSKVEIIAGHTGRNKLVHIQGVTEKQARFILK GT:EXON 1|1-94:0| SW:ID Y717_DESRM SW:DE RecName: Full=UPF0235 protein Dred_0717; SW:GN OrderedLocusNames=Dred_0717; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->94|Y717_DESRM|2e-50|100.0|94/94| BL:PDB:NREP 1 BL:PDB:REP 1->76|1n91A|5e-14|43.4|76/108| RP:PFM:NREP 1 RP:PFM:REP 7->83|PF02594|3e-16|50.6|77/77|DUF167| HM:PFM:NREP 1 HM:PFM:REP 8->82|PF02594|2e-28|48.0|75/78|DUF167| RP:SCP:NREP 1 RP:SCP:REP 4->81|1n91A|5e-23|43.6|78/108|d.206.1.1| HM:SCP:REP 1->95|1n91A_|5.4e-24|41.1|95/108|d.206.1.1|1/1|YggU-like| OP:NHOMO 200 OP:NHOMOORG 199 OP:PATTERN ------------------------------------------------------11--111------- 111-------------------------------------------------------------------------------------------------------------------------111111111111-----111-1---111--------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-----1---------111111-111-----111-111111111-----111----------------------11---111-----1--11111-1111111111111---1-1-------111111-1111111111-111111111111111111111111---1111111111111111111111111-111111111111---------------1--1111111----1111----------11-----11-1------------------11111111111111----------------1------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 89.4 SQ:SECSTR cccEEEcccEEEEEEEEEccccccEEEEEccccEEEEccccccHHHHHHHHHHHHHHHTcccTTTEEEcccTTccEEEEEEEcc########## DISOP:02AL 1-1| PSIPRED cccEEEcccEEEEEEEEcccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHcccHHHEEEEEcccccEEEEEEccccHHHHHHHHc //