[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49260.1
DDBJ      :             glycine cleavage system H protein
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  683/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
b.84.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->124 3iftA PDBj 8e-33 52.5 %
:RPS:PDB   3->126 2edgA PDBj 2e-18 42.7 %
:RPS:SCOP  3->126 1dxmA  b.84.1.1 * 3e-18 48.4 %
:HMM:SCOP  2->128 1onlA_ b.84.1.1 * 1.4e-45 53.5 %
:RPS:PFM   7->125 PF01597 * GCV_H 2e-33 62.2 %
:HMM:PFM   7->125 PF01597 * GCV_H 6.8e-50 55.5 119/122  
:BLT:SWISS 3->124 GCSH_BACHD 1e-45 67.2 %
:PROS 47->76|PS00189|LIPOYL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49260.1 GT:GENE ABO49260.1 GT:PRODUCT glycine cleavage system H protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 775150..775530 GB:FROM 775150 GB:TO 775530 GB:DIRECTION + GB:PRODUCT glycine cleavage system H protein GB:NOTE TIGRFAM: glycine cleavage system H protein PFAM: glycine cleavage H-protein KEGG: chy:CHY_0490 glycine cleavage system H protein GB:PROTEIN_ID ABO49260.1 GB:DB_XREF GI:134051289 InterPro:IPR002930 InterPro:IPR003016 LENGTH 126 SQ:AASEQ MKVPSELKYTKEHEWVKIEGNRAIIGITYYAQDSLGDIVFVELPSVGDAVEVEEPFGVVESVKTASDLYAPVSGQVVEVNNEPMDSPEVVNQDPYGQGWMIMVEMSDPSQIEKLMSAEEYQALIEA GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 3->124|GCSH_BACHD|1e-45|67.2|122/128| PROS 47->76|PS00189|LIPOYL|PDOC00168| BL:PDB:NREP 1 BL:PDB:REP 3->124|3iftA|8e-33|52.5|122/136| RP:PDB:NREP 1 RP:PDB:REP 3->126|2edgA|2e-18|42.7|124/130| RP:PFM:NREP 1 RP:PFM:REP 7->125|PF01597|2e-33|62.2|119/121|GCV_H| HM:PFM:NREP 1 HM:PFM:REP 7->125|PF01597|6.8e-50|55.5|119/122|GCV_H| GO:PFM:NREP 3 GO:PFM GO:0005739|"GO:mitochondrion"|PF01597|IPR002930| GO:PFM GO:0005960|"GO:glycine cleavage complex"|PF01597|IPR002930| GO:PFM GO:0006546|"GO:glycine catabolic process"|PF01597|IPR002930| RP:SCP:NREP 1 RP:SCP:REP 3->126|1dxmA|3e-18|48.4|124/131|b.84.1.1| HM:SCP:REP 2->128|1onlA_|1.4e-45|53.5|127/0|b.84.1.1|1/1|Single hybrid motif| OP:NHOMO 1096 OP:NHOMOORG 892 OP:PATTERN 111-113322222233--------1111--11----------------------11111111111--- 122311-----11111111-1111211111121111113311111111-11-32211211111221311111111111----1531111111-111---113111111111111111111111111111111113111111---1411111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111121--1-11-----1111111-----------------------------------------------------21--1111111-1--111----1---11----31-4-11113112-1--112111111111111111111111111111111111-1111111-211-1111111-1111111111111111112111111111111-111-----------------------------11111-1111111111111111111111111111111111111111111111111--111111111111111111122-2-1111412111-2222222121111111--------------------------3311-111211111111111111111111111--11113------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---111111111111211---------------1111111111112332222222322222222222222211112111111111111111111111111111-111111--------1-1-------------------------1111111111111 12--361-311-111111111111111111111111111111111111112222--1--1--11111111111111111111111111-11111111111111112-121321322111321111213-1A2-1121-111--91-11-11113131121-111112112-22111111I111112474131112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 98.4 SQ:SECSTR ##cccccEEcTTcEEEEEETTEEEEEEcHHHHHHHccEEEEEcccTTcEEcTTcEEEEEEEcccEEEEEccccEEEEEEcccTTTcTTHHHHccccccccEEEEcccTTGGGTcEEHHHHHHHHHT DISOP:02AL 1-1| PSIPRED ccccccccccccEEEEEEEccEEEEEEcHHHHHHcccEEEEEccccccEEccccEEEEEEEEcEEcccccccccEEEEEEHHHHHcHHHHHcccccccEEEEEEEccHHHHHHcccHHHHHHHHcc //