[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49264.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   74->106 PF00403 * HMA 0.00043 28.1 32/62  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49264.1 GT:GENE ABO49264.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(779542..779919) GB:FROM 779542 GB:TO 779919 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49264.1 GB:DB_XREF GI:134051293 LENGTH 125 SQ:AASEQ MAIVYFGGPLDEIRAIMEAGLQAKHRIRATLLEAMIDARNSVGLNRRFKPAVLVIEQLPDTALLNQNSDFSFPCIKNVKSTIKRIYSVKIDFKAPNLASIAGTLSPYAVLQGKNEKHSFHKGVAR GT:EXON 1|1-125:0| HM:PFM:NREP 1 HM:PFM:REP 74->106|PF00403|0.00043|28.1|32/62|HMA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 119-120,123-126| PSIPRED cEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEHHHHcccHHHHccccccccHHHHHHHHHHHHHHEEEEEEccccHHHHHHccccHHHHccccHHHHHHHHHcc //