[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49269.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   23->91 3cuoA PDBj 5e-06 10.1 %
:RPS:SCOP  23->91 2fbiA1  a.4.5.28 * 9e-05 24.6 %
:HMM:SCOP  14->92 1tbxA_ a.4.5.48 * 2.7e-06 22.8 %
:HMM:PFM   20->65 PF02002 * TFIIE_alpha 1e-06 28.3 46/105  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49269.1 GT:GENE ABO49269.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(783640..783915) GB:FROM 783640 GB:TO 783915 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49269.1 GB:DB_XREF GI:134051298 LENGTH 91 SQ:AASEQ MTELTMSQYFKEVNNRLPVEAERVLRALIDEGKMNKEELSLTAKVKRAVLDHVVMQLFALGLVEVTSEGKSKICSLTKLGEEYLDLMREAI GT:EXON 1|1-91:0| RP:PDB:NREP 1 RP:PDB:REP 23->91|3cuoA|5e-06|10.1|69/98| HM:PFM:NREP 1 HM:PFM:REP 20->65|PF02002|1e-06|28.3|46/105|TFIIE_alpha| RP:SCP:NREP 1 RP:SCP:REP 23->91|2fbiA1|9e-05|24.6|69/136|a.4.5.28| HM:SCP:REP 14->92|1tbxA_|2.7e-06|22.8|79/94|a.4.5.48|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--211-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 75.8 SQ:SECSTR ######################HHHHHHTTcccEEHHHHHHHHcccHHHHHHHHHHHHHTTcEEEEEccccEEEEEccHHHHHHHHHHHHH DISOP:02AL 1-2,6-6| PSIPRED ccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHc //