[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49273.1
DDBJ      :             D-tyrosyl-tRNA(Tyr) deacylase
Swiss-Prot:DTD_DESRM    RecName: Full=D-tyrosyl-tRNA(Tyr) deacylase;         EC=3.1.-.-;

Homologs  Archaea  1/68 : Bacteria  620/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
c.110.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->147 2dboA PDBj 8e-29 42.9 %
:RPS:PDB   1->147 2dboA PDBj 1e-45 42.9 %
:RPS:SCOP  1->144 1j7gA  c.110.1.1 * 2e-45 39.9 %
:HMM:SCOP  1->145 1j7gA_ c.110.1.1 * 1.7e-57 59.6 %
:RPS:PFM   2->144 PF02580 * Tyr_Deacylase 6e-35 49.7 %
:HMM:PFM   2->145 PF02580 * Tyr_Deacylase 1.1e-54 54.2 144/145  
:BLT:SWISS 1->149 DTD_DESRM 7e-66 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49273.1 GT:GENE ABO49273.1 GT:PRODUCT D-tyrosyl-tRNA(Tyr) deacylase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 789540..789989 GB:FROM 789540 GB:TO 789989 GB:DIRECTION + GB:PRODUCT D-tyrosyl-tRNA(Tyr) deacylase GB:NOTE PFAM: D-tyrosyl-tRNA(Tyr) deacylase KEGG: sfu:Sfum_2470 D-tyrosyl-tRNA(Tyr) deacylase GB:PROTEIN_ID ABO49273.1 GB:DB_XREF GI:134051302 InterPro:IPR003732 LENGTH 149 SQ:AASEQ MRAVVQRVLKGSVTVNNEVVGKIGQGLVVLLGVGQGDCVDDARYLADKISQLRIFDDEQGKLNLSIQDVKGSILAISQFTLYGDCRKGRRPGYSGAAAPDTARELYESFVQRLVCNGLTTSTGVFQEHMVVEIINDGPVTLLLDSRKGF GT:EXON 1|1-149:0| SW:ID DTD_DESRM SW:DE RecName: Full=D-tyrosyl-tRNA(Tyr) deacylase; EC=3.1.-.-; SW:GN Name=dtd; OrderedLocusNames=Dred_0734; SW:KW Complete proteome; Cytoplasm; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|DTD_DESRM|7e-66|100.0|149/149| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 19->41|vvgkigqglvvllgvgqgdcvdd| BL:PDB:NREP 1 BL:PDB:REP 1->147|2dboA|8e-29|42.9|147/148| RP:PDB:NREP 1 RP:PDB:REP 1->147|2dboA|1e-45|42.9|147/148| RP:PFM:NREP 1 RP:PFM:REP 2->144|PF02580|6e-35|49.7|143/144|Tyr_Deacylase| HM:PFM:NREP 1 HM:PFM:REP 2->145|PF02580|1.1e-54|54.2|144/145|Tyr_Deacylase| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF02580|IPR003732| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF02580|IPR003732| GO:PFM GO:0019478|"GO:D-amino acid catabolic process"|PF02580|IPR003732| RP:SCP:NREP 1 RP:SCP:REP 1->144|1j7gA|2e-45|39.9|143/144|c.110.1.1| HM:SCP:REP 1->145|1j7gA_|1.7e-57|59.6|141/144|c.110.1.1|1/1|DTD-like| OP:NHOMO 812 OP:NHOMOORG 787 OP:PATTERN ---------------------------------1---------------------------------- -11-111111111-11111-11--1111111111111-111---111-1------11---111111111111111111-11111-11111111111---11111111111--------------111-11----111111111111111111-----------1-----11------------1111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------------------------------------------------------------1111111111--------------------------------------------------------1111111111111111111111111111--111-111111111-111----111111111---11111111111111111111111111111111111----------------------11---1-1111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1-----111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------1-----------------1-------------------------1111111111111 1111111-3111-1111-1111111-1111111-11121111111-111111111111111111-111-1111111111-1222111--111111111111-1111-11-2111-1111-1111121211A1-111-1-11-11--1-11111111111--11111-111-1111-111711-111111-11-1111-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 98.7 SQ:SECSTR cEEEEEEEEEEEEEETTEEEEEEccEEEEEEEccTTccHHHHHHHHHHHHHccccccccccccccTTTTTcEEEEEEcGGGGcccccccccccTTcccHHHHHHHHHHHHHHHHTTcccEEEcccccccEEEEEEEEEEEEEEEGGG## DISOP:02AL 94-99| PSIPRED cEEEEEEEEEEEEEEccEEEEEccccEEEEEEEcccccHHHHHHHHHHHHccEEEEcccccccccHHHccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEccccEEEEEEccccc //