[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49282.1
DDBJ      :             extracellular solute-binding protein, family 3
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  698/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->259 1hslA PDBj 6e-32 35.6 %
:RPS:PDB   37->257 3delB PDBj 2e-41 21.8 %
:RPS:SCOP  42->254 1gggA  c.94.1.1 * 5e-48 32.9 %
:HMM:SCOP  4->258 2a5sA1 c.94.1.1 * 2.2e-65 33.9 %
:RPS:PFM   47->253 PF00497 * SBP_bac_3 1e-34 40.1 %
:HMM:PFM   42->254 PF00497 * SBP_bac_3 5.4e-69 41.3 213/225  
:BLT:SWISS 23->257 YXEM_BACSU 4e-37 37.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49282.1 GT:GENE ABO49282.1 GT:PRODUCT extracellular solute-binding protein, family 3 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(796389..797171) GB:FROM 796389 GB:TO 797171 GB:DIRECTION - GB:PRODUCT extracellular solute-binding protein, family 3 GB:NOTE PFAM: extracellular solute-binding protein, family 3 KEGG: bce:BC0402 cystine-binding protein GB:PROTEIN_ID ABO49282.1 GB:DB_XREF GI:134051311 InterPro:IPR000437 InterPro:IPR001638 LENGTH 260 SQ:AASEQ MFNKKSIAFLLTLIIISTLVVGCGGTSNSTSATPDKKKFHYAMSGLYKPFNYKDGGKLVGFDVEIGEEIARRIGMEAAPVTNPWETIIQGLKANKYDAIIGSMAITEERQEQVDFSRPYYRSGAQVFVSSNNDSITSAKDLKGKKIGVVKASTFRNVALEYTDKKNVIGYDSDVIALQDLPTGRVDAVITDQMVGIVAIKNGLKIKDVDKPLWVDEMAIPVNKGNTELVNKINNALDEMIKDGTYEKISNKWFGRNILGD GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 23->257|YXEM_BACSU|4e-37|37.3|233/264| TM:NTM 1 TM:REGION 6->24| SEG 6->19|siaflltliiistl| BL:PDB:NREP 1 BL:PDB:REP 37->259|1hslA|6e-32|35.6|219/238| RP:PDB:NREP 1 RP:PDB:REP 37->257|3delB|2e-41|21.8|220/232| RP:PFM:NREP 1 RP:PFM:REP 47->253|PF00497|1e-34|40.1|207/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 42->254|PF00497|5.4e-69|41.3|213/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 42->254|1gggA|5e-48|32.9|213/220|c.94.1.1| HM:SCP:REP 4->258|2a5sA1|2.2e-65|33.9|251/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3327 OP:NHOMOORG 731 OP:PATTERN 11---1----------1-2222112--11-1111----76993-1113-1--2----1------1--- ----1211---12-32211-17112B1111118555368A-2123131222-765224--111-6566352744454421221-----11-------------------111111111211111-----1--4---111211111--114--23211-------11-234-------------5441132--263444447544554453332674453225554444443A422221221222222222222564687775566666773646843336666555488888999988894554455654555488CBB88872465B453555523245332333133213313177-5121-2111122281--111-1211212535111111115653526656J---6--6-539-1SGGFGEDHCIDFC4---13742342221111111122211122----------111111111111111--1-2-----48669KMMNNK89AA9GGELAAAA79LFL3542--7781255484A9BC-13----743322222------1592677B35C88946165-42-132-31--4-6436333333111111111-33----685-3-----6-1111-13111131211212-4-1--------76FE5A96665664666-6666666566666566558HKFFD4427667777777777777D665656631867777776777--311111177771-56833353522222222133333-3254-1A98A9IDJ87A772988--1111-1-14447444445555511--------------37--------------2-3-------------------------131-213111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 92.7 SQ:SECSTR ###################cTTTcEEEEccTTTTTccEEEEEEccccTTTcEEcTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEccccccccGGGcccEEEETTcHHHHHHHHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGEEEEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGcETc DISOP:02AL 1-4,260-261| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccEEEEEEEcccccEEEEEccEEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHHcccEEEccEEEEEEEcccccccHHHHcccEEEEEcccHHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHccccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccc //