[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49286.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->130 1s3jB PDBj 3e-09 31.6 %
:RPS:PDB   13->129 3bpxB PDBj 4e-13 21.4 %
:RPS:SCOP  34->131 2ethA1  a.4.5.28 * 1e-17 23.5 %
:HMM:SCOP  4->144 1jgsA_ a.4.5.28 * 3.8e-27 33.3 %
:RPS:PFM   33->89 PF01047 * MarR 2e-05 35.1 %
:HMM:PFM   33->91 PF01047 * MarR 1.4e-20 37.3 59/59  
:BLT:SWISS 10->131 YPOP_BACSU 5e-13 27.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49286.1 GT:GENE ABO49286.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(800544..800981) GB:FROM 800544 GB:TO 800981 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MarR family GB:NOTE PFAM: regulatory protein, MarR KEGG: lin:lin1964 hypothetical protein GB:PROTEIN_ID ABO49286.1 GB:DB_XREF GI:134051315 InterPro:IPR000835 LENGTH 145 SQ:AASEQ MDKRKKIIAIDMLFHDLVKNSSCQLKELLKDLITPTQFFLLKIIASQETCKAADIAHIFDITPAAATTIIDRLYKNGLIERNRSEKDRRIVWLKLTENGRQLLSDIEAMRIQMLVKQFANITDGEMQTLYEVLKKVLDKDLVDPD GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 10->131|YPOP_BACSU|5e-13|27.9|122/141| SEG 132->143|vlkkvldkdlvd| BL:PDB:NREP 1 BL:PDB:REP 30->130|1s3jB|3e-09|31.6|98/134| RP:PDB:NREP 1 RP:PDB:REP 13->129|3bpxB|4e-13|21.4|117/138| RP:PFM:NREP 1 RP:PFM:REP 33->89|PF01047|2e-05|35.1|57/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 33->91|PF01047|1.4e-20|37.3|59/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 34->131|2ethA1|1e-17|23.5|98/140|a.4.5.28| HM:SCP:REP 4->144|1jgsA_|3.8e-27|33.3|135/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 112 OP:NHOMOORG 78 OP:PATTERN -------1-------------------------------------------------------1---- ------------------------------------------------------------11--------------------------------------------------------------------------2-------------------------------------------------------24222222222222222--222322211---1-11111123-------------------------------------------------------------------------------------------1--1---------1---------1------11---21---1--------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1-----------1-----------------------------------------1--1---------------------------------------------1-1111--11111--1-1-1--------------------------------------------------------------------------------------------------------------------------------------------1----------------------------22-11111--1---------------------------------------------------------------1----1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 89.7 SQ:SECSTR #HHHHHHccHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHH############## DISOP:02AL 1-2,140-146| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccc //