[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49291.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->107 PF01040 * UbiA 2.3e-05 19.7 76/258  
:BLT:SWISS 49->117 COX1A_STRCO 3e-04 33.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49291.1 GT:GENE ABO49291.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 806260..806625 GB:FROM 806260 GB:TO 806625 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49291.1 GB:DB_XREF GI:134051320 LENGTH 121 SQ:AASEQ MLINRIMIGCVTLIILVAAGYYGGKDIEAWLRIFPVILLILIAFITKKWRIKRKAKEIDERLQMITYYALSVGFYSILGVLFWFYTEEMVQEGALSLRTQMEMYAGLLGYLGAYFYFKKRF GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 49->117|COX1A_STRCO|3e-04|33.3|69/578| TM:NTM 3 TM:REGION 1->22| TM:REGION 25->46| TM:REGION 68->90| HM:PFM:NREP 1 HM:PFM:REP 6->107|PF01040|2.3e-05|19.7|76/258|UbiA| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //