[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49299.1
DDBJ      :             UBA/THIF-type NAD/FAD binding protein
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  646/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
c.111.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->144 1jwaB PDBj 3e-16 32.4 %
:RPS:PDB   4->180 3cmmA PDBj 8e-40 20.3 %
:RPS:SCOP  3->194 1jw9B  c.111.1.1 * 5e-36 25.3 %
:HMM:SCOP  3->248 1yovB1 c.111.1.2 * 8.9e-64 34.8 %
:RPS:PFM   22->151 PF00899 * ThiF 4e-22 44.2 %
:HMM:PFM   24->151 PF00899 * ThiF 3.6e-42 44.9 127/136  
:BLT:SWISS 5->244 YGDL_ECOLI 4e-44 40.0 %
:PROS 79->93|PS00819|DPS_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49299.1 GT:GENE ABO49299.1 GT:PRODUCT UBA/THIF-type NAD/FAD binding protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 815254..815994 GB:FROM 815254 GB:TO 815994 GB:DIRECTION + GB:PRODUCT UBA/THIF-type NAD/FAD binding protein GB:NOTE PFAM: UBA/THIF-type NAD/FAD binding protein KEGG: btk:BT9727_4134 HesA/MoeB/ThiF family protein GB:PROTEIN_ID ABO49299.1 GB:DB_XREF GI:134051328 InterPro:IPR000594 InterPro:IPR002177 LENGTH 246 SQ:AASEQ MNLHRFSRTEMLIGEEGLAKLAAAKVIVFGVGGVGSYTVEALARAGVGELTLVDFDTVDITNINRQLHAMDNTIGQYKVDLMAERVQLINPQAKVLPLKMFYTPENGDDLLTKGYTYVIDAIDNVTGKIDIIQRCYKNNISVISCMGAGNKLDPAAFRVADISETSVDPLARVIRRELRKHDIHKGVKVVFSLESPLVPRTKLTKAKNDTEVGARQKSLAPGSISFVPAAAGLIMAGAVVREIIQV GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 5->244|YGDL_ECOLI|4e-44|40.0|240/268| PROS 79->93|PS00819|DPS_2|PDOC00645| BL:PDB:NREP 1 BL:PDB:REP 5->144|1jwaB|3e-16|32.4|139/217| RP:PDB:NREP 1 RP:PDB:REP 4->180|3cmmA|8e-40|20.3|177/1001| RP:PFM:NREP 1 RP:PFM:REP 22->151|PF00899|4e-22|44.2|129/135|ThiF| HM:PFM:NREP 1 HM:PFM:REP 24->151|PF00899|3.6e-42|44.9|127/136|ThiF| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00899|IPR000594| RP:SCP:NREP 1 RP:SCP:REP 3->194|1jw9B|5e-36|25.3|190/240|c.111.1.1| HM:SCP:REP 3->248|1yovB1|8.9e-64|34.8|224/0|c.111.1.2|1/1|Activating enzymes of the ubiquitin-like proteins| OP:NHOMO 1479 OP:NHOMOORG 844 OP:PATTERN --1-111-111111111-1111--1---1-11111----1---231121111---1-1--11----11 11--1211---11111122-21111122222111111111111----1111-111--1--1111-1-1-111---111111211111122221111---11221-11112---------------1111-11111111111----111111111111---111--1111111-1-111-1111-----11--122222223233222222211222322122-21-111-13221111111111111122212-------1---11-1------1--------2--------------------------------1-1----42321222222212122222221312-2-2111222331-132321411112----11-21-11111111-11-1----------1-11-11-11-11-111-11111121-----1---1--11-11111111111-----111-111111-------------------111--1222221222211222222222222222221121111112122112232212213211211111111122121-2-213---1----34314245222322---211221111211122121221221222222221222123222222322223322232--11121------31331113333333323-3333333233333333333232213333333333333333333122233331-211121111121---31111111-111111223222122222222222222221232322221122222222221-1--11--23222333331222211222222232222112-11------------1-----------------------------1---1---112 --44221-9441233-222211111121111112123113133222222211322134233322223211332414324433323234-141211222233612422123211-23----111-1-----1---11------1-111------2--2-1---13311--112122-233F3322352273314422133 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 80.9 SQ:SECSTR ccccTTHHHHHHHcHHHHHHHHTcEEEEEcccHHHHHHHHHHHHcTTcEEEEEccccccGGGTTTcTTccGGGTTccHHHHHHHHHHHHcGGGTTTEEEEcccccGGGTTHHHHccEEEEccccHHHHHHHHHHHHHHTccEEEEEEETTEEEEEEEcTTTcccGGGccccccccccHHHccEEEEEEccEEETTcccc############################################### DISOP:02AL 1-1| PSIPRED ccHHHcccEEEEEcHHHHHHHHHccEEEEcccHHHHHHHHHHHHHcccEEEEEEccEEcHHHHcccccccHHHcccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEEcccccccccEEEEEEcccccccccHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcc //