[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49301.1
DDBJ      :             transcriptional regulator, BadM/Rrf2 family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  629/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   38->105 3ba6A PDBj 5e-06 24.6 %
:RPS:SCOP  10->118 1f6vA  a.49.1.1 * 4e-16 18.4 %
:HMM:SCOP  2->138 1ylfA1 a.4.5.55 * 1.1e-38 45.9 %
:RPS:PFM   1->83 PF02082 * Rrf2 2e-21 53.0 %
:HMM:PFM   1->83 PF02082 * Rrf2 2e-32 54.2 83/83  
:BLT:SWISS 1->132 CYMR_BACSU 5e-36 54.5 %
:PROS 49->67|PS01332|HTH_RRF2_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49301.1 GT:GENE ABO49301.1 GT:PRODUCT transcriptional regulator, BadM/Rrf2 family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 816652..817101 GB:FROM 816652 GB:TO 817101 GB:DIRECTION + GB:PRODUCT transcriptional regulator, BadM/Rrf2 family GB:NOTE TIGRFAM: putative transcriptional regulator, Rrf2 family PFAM: protein of unknown function UPF0074 KEGG: mta:Moth_1653 transcriptional regulator, BadM/Rrf2 family GB:PROTEIN_ID ABO49301.1 GB:DB_XREF GI:134051330 InterPro:IPR000944 LENGTH 149 SQ:AASEQ MRLSTKGHYGLKAMFDLAMHYGSEPIPLKVVAERQNISEHYLEQLIAVLRKVGLVKSIRGAQGGYILAKPPSDIKVGDVVRALEGPIAPLDCVSELEPTVCEKVDYCISRDIWARVRDSIAEVLDSITLEDMCLEAQKAQSNQIESKHI GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 1->132|CYMR_BACSU|5e-36|54.5|123/138| PROS 49->67|PS01332|HTH_RRF2_1|PDOC01035| RP:PDB:NREP 1 RP:PDB:REP 38->105|3ba6A|5e-06|24.6|65/993| RP:PFM:NREP 1 RP:PFM:REP 1->83|PF02082|2e-21|53.0|83/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 1->83|PF02082|2e-32|54.2|83/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 10->118|1f6vA|4e-16|18.4|87/91|a.49.1.1| HM:SCP:REP 2->138|1ylfA1|1.1e-38|45.9|135/0|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1066 OP:NHOMOORG 629 OP:PATTERN -------------------------------------------------------------------- 11513----------1111-11--11111111111121111-11----------------111----2--1-------12332--1---------------1-12211-2---------------121222111111111111-1121231112222------11233241------------2221122-31133333222131122134333113222223122222222211111111111111-11121----------------------------------------------------------------------11143333434414121111111235111113122322112321112-1-1122223-111113--1111-----11111111112-1111111-223-344133233333121-12124544221222222222--1-5451--1122211111122-1111-11-----11222211111111111111111112111111211122211222111222233112211212111122122122321-1-1-225253445-463244431221221113---1111111---------1112111222122111222222222222222222222---2243------22222222222222222-2222222222222222222222222222222222222222222222222221-222222222222---2111-1222222211111111111111111111111111112111111111111-1111---------222221111111111--11111111----113-------------------------------------------112--21222121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 81.2 SQ:SECSTR ##########HHHHHHHHHTcTTccccHHHHHHHHTcHHHHHHHHHTTcccEEEEEEEcTTccccEEcEEGGGccTTcEEEEETTcccccEEEEEEEcccccEEEccccccEEEEEEHHHHHHHHHHHHcT################## DISOP:02AL 1-1,135-135,137-150| PSIPRED ccccHHHHHHHHHHHHHHHcccccEEEHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHccccccEEcccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc //