[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49303.1
DDBJ      :             nitrogen-fixing NifU domain protein
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  613/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
d.224.1d.87.2
:123 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->121 2z7eC PDBj 2e-40 60.0 %
:RPS:PDB   1->111 2e5aA PDBj 9e-19 9.0 %
:RPS:SCOP  39->98 1t3qC1  d.87.2.1 * 8e-04 22.4 %
:HMM:SCOP  1->121 1xjsA_ d.224.1.2 * 1.6e-46 50.0 %
:RPS:PFM   1->117 PF01592 * NifU_N 9e-35 55.6 %
:HMM:PFM   1->122 PF01592 * NifU_N 1.3e-54 58.2 122/127  
:BLT:SWISS 2->121 NIFU_AQUAE 6e-41 60.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49303.1 GT:GENE ABO49303.1 GT:PRODUCT nitrogen-fixing NifU domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 818403..818774 GB:FROM 818403 GB:TO 818774 GB:DIRECTION + GB:PRODUCT nitrogen-fixing NifU domain protein GB:NOTE PFAM: nitrogen-fixing NifU domain protein KEGG: chy:CHY_2198 putative FeS assembly protein GB:PROTEIN_ID ABO49303.1 GB:DB_XREF GI:134051332 InterPro:IPR002871 LENGTH 123 SQ:AASEQ MYTEKVMDHFTNPRNVGEIENADGIGQVGNPSCGDIMKITLKVEDNIIKDIKFKTFGCGAAVATSSMVTEMAMGKTIDEALTITNKAVAEALEGLPPAKMHCSNLAADALKVAIEDYLKKQNV GT:EXON 1|1-123:0| BL:SWS:NREP 1 BL:SWS:REP 2->121|NIFU_AQUAE|6e-41|60.8|120/157| BL:PDB:NREP 1 BL:PDB:REP 2->121|2z7eC|2e-40|60.0|120/137| RP:PDB:NREP 1 RP:PDB:REP 1->111|2e5aA|9e-19|9.0|100/329| RP:PFM:NREP 1 RP:PFM:REP 1->117|PF01592|9e-35|55.6|117/126|NifU_N| HM:PFM:NREP 1 HM:PFM:REP 1->122|PF01592|1.3e-54|58.2|122/127|NifU_N| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01592|IPR002871| GO:PFM GO:0016226|"GO:iron-sulfur cluster assembly"|PF01592|IPR002871| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF01592|IPR002871| RP:SCP:NREP 1 RP:SCP:REP 39->98|1t3qC1|8e-04|22.4|58/109|d.87.2.1| HM:SCP:REP 1->121|1xjsA_|1.6e-46|50.0|120/0|d.224.1.2|1/1|SufE/NifU| OP:NHOMO 1014 OP:NHOMOORG 820 OP:PATTERN -----------------------21111111111--------11212111332-----------1-1- 1221--11111-1-2--------------------------111-------------------1111---1--------111311111-----------------1---1---------------111111111111222211123-11111-2211---------12111---------------11111111111111111111111112211111111111111111111111111111111111111111------1-1111111111----1111111111111111111111111111111111111111111111111112111111111111441111111111-11-11222-1112221111-2-1----------1------11111--------------1------1----------------------1111------------11--11-11111111111111111111111111111------11111111111122221111222222122112111111211221222121121121111111111--1122-5422221112111111121214321222134111111111111111111111111222112---1-1121111111111111112111--11--2111111112111-1111111111-111111111111111111112121221111111111111111111111111--111111111111---11111111111----11111111111111111111111112-11111111111112111----------11111111111111--------------1111112222--------------------------------------1111111111- 1111111-311111211111111111111111111111-1111-11111111111111111111111111221112222211111111-121111111111-12221-21223222111---1131121492-21611111114---1111-13121111-1111111115111111-1I1111132531321111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 98.4 SQ:SECSTR THHHHHHHHHcHHHHTTTcccEEEEEEEEEEccEEEEEEEEEEETTEEEEEEEEccTTTccHHHHHHHHHHHTTccccccTTTcHHHHHHHHTcccHHHHHHHHHHHHHHTHHHHHHHHHT## DISOP:02AL 122-124| PSIPRED ccHHHHHHHHHccccccccccccEEEEEcccccccEEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcc //