[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49305.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->45 PF06044 * DRP 7.2e-05 31.8 44/254  
:BLT:SWISS 3->50 YRZR_BACSU 9e-11 45.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49305.1 GT:GENE ABO49305.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 820100..820273 GB:FROM 820100 GB:TO 820273 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: chy:CHY_0535 hypothetical protein GB:PROTEIN_ID ABO49305.1 GB:DB_XREF GI:134051334 LENGTH 57 SQ:AASEQ MNCPICGGKATGKVGIDQYYCWDCCVEYRLKKEGVDVFEVAEDGSLVSFDPHNTGLY GT:EXON 1|1-57:0| BL:SWS:NREP 1 BL:SWS:REP 3->50|YRZR_BACSU|9e-11|45.8|48/100| HM:PFM:NREP 1 HM:PFM:REP 2->45|PF06044|7.2e-05|31.8|44/254|DRP| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------------11---1---111-----------1----------------------------------------------------------------------------------------------------------------------1---1-11111--11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,55-58| PSIPRED ccccccccccccccccccEEEEEEEEEEEEEcccEEEEEEcccccEEEccccccccc //