[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49306.1
DDBJ      :             protein of unknown function UPF0118
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  600/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
:343 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   34->335 PF01594 * UPF0118 4e-37 35.7 %
:HMM:PFM   13->335 PF01594 * UPF0118 3.1e-76 31.8 321/327  
:BLT:SWISS 49->335 YRRI_BACSU 2e-41 31.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49306.1 GT:GENE ABO49306.1 GT:PRODUCT protein of unknown function UPF0118 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 820580..821611 GB:FROM 820580 GB:TO 821611 GB:DIRECTION + GB:PRODUCT protein of unknown function UPF0118 GB:NOTE PFAM: protein of unknown function UPF0118 KEGG: mta:Moth_1647 protein of unknown function UPF0118 GB:PROTEIN_ID ABO49306.1 GB:DB_XREF GI:134051335 InterPro:IPR002549 LENGTH 343 SQ:AASEQ MAWWKEKCTYRYLFLSFLIGLILFFLYLIRGLFVPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLGVVIVATSLLMYGVPRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVLAIVRKSMDLLMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRGHLTVVVIVGILSSLAFMVIGLEFAAMFGIIAGIAELIPYFGPLIGAAPAVGIALLHSKYMTLKVILAVLIIQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAAIIKIIVSFVWRKLI GT:EXON 1|1-343:0| BL:SWS:NREP 1 BL:SWS:REP 49->335|YRRI_BACSU|2e-41|31.9|285/353| TM:NTM 8 TM:REGION 7->29| TM:REGION 31->53| TM:REGION 68->90| TM:REGION 156->178| TM:REGION 210->232| TM:REGION 236->258| TM:REGION 262->284| TM:REGION 307->329| SEG 12->33|ylflsfliglilfflylirglf| SEG 233->244|faamfgiiagia| RP:PFM:NREP 1 RP:PFM:REP 34->335|PF01594|4e-37|35.7|300/328|UPF0118| HM:PFM:NREP 1 HM:PFM:REP 13->335|PF01594|3.1e-76|31.8|321/327|UPF0118| OP:NHOMO 1039 OP:NHOMOORG 616 OP:PATTERN -----------------------1--------1-1----1-1--------111--------------- -21-22-11111-2-------1-----------111-----1112---11121111-----------211--------11122-----1111-111----1111-33211--------------1-----1---1-22213---4-325411211--------122-3252---11-1---11312----111433333333333333322443333311123332333331122222222222222222222513322321112211222122222222222222222222222222222122122222212422221222213234333333333323112544342212321-11123221212221-12--31---1111111------------1111111111-22122121321-11111111211122---113121111111111111111-21211111111111---------------111----1--------------------1----------111-1111-1-1----1---11---11-1-------11-11--111-13--1------3-1333-1121131--1---1-------------------2--11122111-111222212222221211222--25112------21---3-3333333333-3333333333333333331222--111212122222212221122323333--111111111111--12---1-11111112-11111111-1112211111111111112222111121111211111111111111111111111111122221221111-1---1-111111-------------------------------------11--1-1-1-11 ------------------------------------------------------------------------------------------------------------1------------------------------------------------------1------1-----------------2-----2111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcEEEHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //