[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49309.1
DDBJ      :             extracellular solute-binding protein, family 3
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  727/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->263 1wdnA PDBj 6e-57 51.1 %
:RPS:PDB   40->261 3delB PDBj 1e-48 25.0 %
:RPS:SCOP  42->261 1gggA  c.94.1.1 * 5e-51 49.3 %
:HMM:SCOP  1->263 2a5sA1 c.94.1.1 * 2.7e-75 41.5 %
:RPS:PFM   42->258 PF00497 * SBP_bac_3 1e-39 39.9 %
:HMM:PFM   42->260 PF00497 * SBP_bac_3 5.9e-75 41.1 219/225  
:BLT:SWISS 1->263 GLNH_ECOLI 2e-58 51.6 %
:PROS 64->77|PS01039|SBP_BACTERIAL_3
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49309.1 GT:GENE ABO49309.1 GT:PRODUCT extracellular solute-binding protein, family 3 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 826695..827489 GB:FROM 826695 GB:TO 827489 GB:DIRECTION + GB:PRODUCT extracellular solute-binding protein, family 3 GB:NOTE PFAM: extracellular solute-binding protein, family 3 SMART: ionotropic glutamate receptor KEGG: chy:CHY_0504 glutamine ABC transporter, glutamine-binding protein GB:PROTEIN_ID ABO49309.1 GB:DB_XREF GI:134051338 InterPro:IPR000437 InterPro:IPR001320 InterPro:IPR001638 LENGTH 264 SQ:AASEQ MKRIFKTVLTGLTILALALVAVGCTGKEEAKSPAQDTGKKKLVAAADATFAPFEFTDSSGKYVGFDLDLIAAIAEEMGYELEFQSIAFDGIIPALQSSQIDCAATAMTITPERSKAVNFSDPYYKAGQIVVVKTENNDIKGVNDLKGKTIAVQSGTTGAMEAEKATDKKKVIYFTGADQALQELKNGAANAVIIDYPVAAYFIQQGNKDVKLVGDIMSAEEYGIAVPKDKEQILADVNAGLKKIKENGKYAEIYKKWFGEEPRS GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 1->263|GLNH_ECOLI|2e-58|51.6|246/248| PROS 64->77|PS01039|SBP_BACTERIAL_3|PDOC00798| TM:NTM 1 TM:REGION 4->25| BL:PDB:NREP 1 BL:PDB:REP 41->263|1wdnA|6e-57|51.1|221/223| RP:PDB:NREP 1 RP:PDB:REP 40->261|3delB|1e-48|25.0|220/232| RP:PFM:NREP 1 RP:PFM:REP 42->258|PF00497|1e-39|39.9|213/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 42->260|PF00497|5.9e-75|41.1|219/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 42->261|1gggA|5e-51|49.3|219/220|c.94.1.1| HM:SCP:REP 1->263|2a5sA1|2.7e-75|41.5|253/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3695 OP:NHOMOORG 764 OP:PATTERN 11---1----------1-2222212--11-1111----6689311114-1--1----1------1--- ----332433334222211-19112D111111A88835BB15123131222-656225--112-7547472644465531331------11------------------11111111121222211-1-1--5-1-111331112-35453354322-------3115571-1-1---1-1--2441123--2634444475445544533326744532255444444439422222222222222222223564798775566666773646843448887555499777988877785554455554555488B9988882475A453555523245332333232213333177-5121-211112128---11111211222D64111111115653526656J---9--5-86B-1SHHEFDEJIKDGE5---13832332451111111132211223----------111111111111111--1-2-----4B99BLMMMNL77887FFHP99997AMEP6B96-1AAB43A54B6DAFG-24-112753322222---12-16D3699B47A77846168-621232-31--5-6437333343212222222232----675-311---611111-241112243224-2-6-1-2------88FG7977776775777-7787777677777677669GIECA563C8798A9999A99998C766767741978878887777--31111117777-146833353522222222144444-536511BABBAJEJ88A88499B---------334474444444533----------------3711--11--------2-3--1----------------------231-125212-11 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2------1--1-----------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 256 STR:RPRED 97.0 SQ:SECSTR ########EEEEEcccTTTcEEEEccccccccTTccTTccEEEEEEccccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEccccccccGGGcccEEEETTcHHHHHHHHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGTcTTEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGccc DISOP:02AL 1-2,262-265| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHccEEEEEEEcccccEEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHcccccEEEccEEEEEEccccccccHHHHcccEEEEEcccHHHHHHHHHcccccEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccc //