[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49310.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->109 PF11827 * DUF3347 8.5e-05 20.8 48/175  
:PROS 45->66|PS00605|ATPASE_C
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49310.1 GT:GENE ABO49310.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 827608..827982 GB:FROM 827608 GB:TO 827982 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49310.1 GB:DB_XREF GI:134051339 InterPro:IPR000454 LENGTH 124 SQ:AASEQ MFFQPRKPSPPPKGMPVGTGIPGINLSLDVNHVQVLGTLLMMGLSRQPGFKEQMEEFMLFMQRMQEAAETISVQMENVYQEYAKVKAKAVKTNQENVQQKAGRRQEGLTYVNPLLQHLLRLMSY GT:EXON 1|1-124:0| PROS 45->66|PS00605|ATPASE_C|PDOC00526| SEG 5->16|prkpspppkgmp| HM:PFM:NREP 1 HM:PFM:REP 56->109|PF11827|8.5e-05|20.8|48/175|DUF3347| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14,91-106| PSIPRED ccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHcHHHHHHHHHHHHHHHcc //