[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49311.1
DDBJ      :             protein of unknown function DUF965
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  174/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->83 PF06135 * DUF965 2e-15 48.7 %
:HMM:PFM   7->84 PF06135 * DUF965 2.8e-42 66.7 78/79  
:BLT:SWISS 6->62 Y151_CLOTH 3e-20 68.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49311.1 GT:GENE ABO49311.1 GT:PRODUCT protein of unknown function DUF965 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 828137..828397 GB:FROM 828137 GB:TO 828397 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF965 GB:NOTE PFAM: protein of unknown function DUF965 KEGG: mta:Moth_1643 protein of unknown function DUF965 GB:PROTEIN_ID ABO49311.1 GB:DB_XREF GI:134051340 InterPro:IPR009309 LENGTH 86 SQ:AASEQ MAQDFSQETVMFKVQAEEVNQAREILLAVYAALKEKGYNPINQLVGYLLSGDPAYITSHGNARSLIRRLERDELLEELVKNYLDQK GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 6->62|Y151_CLOTH|3e-20|68.4|57/90| SEG 63->78|rslirrlerdelleel| RP:PFM:NREP 1 RP:PFM:REP 8->83|PF06135|2e-15|48.7|76/79|DUF965| HM:PFM:NREP 1 HM:PFM:REP 7->84|PF06135|2.8e-42|66.7|78/79|DUF965| OP:NHOMO 174 OP:NHOMOORG 174 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111-11111111111111111111111111111111---11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,85-87| PSIPRED ccccccccEEEEEcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc //