[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49324.1
DDBJ      :             protein kinase
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  429/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
d.144.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->239 3f69B PDBj 3e-18 30.4 %
:RPS:PDB   13->281 3dk6A PDBj 1e-16 17.1 %
:RPS:SCOP  6->265 1nw1A  d.144.1.8 * 1e-18 6.7 %
:HMM:SCOP  5->273 1howA_ d.144.1.7 * 6.5e-51 31.8 %
:RPS:PFM   22->265 PF00069 * Pkinase 2e-20 32.8 %
:HMM:PFM   22->271 PF00069 * Pkinase 3.7e-38 29.5 241/260  
:BLT:SWISS 25->278 PKNX_STRCO 3e-23 29.6 %
:PROS 137->149|PS00108|PROTEIN_KINASE_ST
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49324.1 GT:GENE ABO49324.1 GT:PRODUCT protein kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 842628..843482 GB:FROM 842628 GB:TO 843482 GB:DIRECTION + GB:PRODUCT protein kinase GB:NOTE PFAM: protein kinase SMART: tyrosine protein kinase; serine/threonine protein kinase KEGG: reh:H16_A0884 hypothetical protein GB:PROTEIN_ID ABO49324.1 GB:DB_XREF GI:134051353 InterPro:IPR000719 InterPro:IPR001245 InterPro:IPR002290 InterPro:IPR008271 LENGTH 284 SQ:AASEQ MIKEFKPDISQIKVLFPELVDLQEIGPGGQKLVYSAKHPEHGLIVLKLIKPGSPTTRQRTLRELYIASELKGACFAKLHGFGDINIENEEVIFIMEEYIDGNTLRALIQAKSLSLKEIILIGKELLHALDVVDQKGLVHRDVKPENIIVSKSRIVLLDFGIARHLNLSSLTDDMAMFGPMTPGYAAPEQIKNEKRRICSRTDLFSWGVVMYECITGKNPFIDGCATPQEILIKTIKYNPPTILEINYKFSKVIDKCLKKVIHRRPISAKMVLENLEGCEKDLCP GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 25->278|PKNX_STRCO|3e-23|29.6|250/673| PROS 137->149|PS00108|PROTEIN_KINASE_ST|PDOC00100| SEG 111->126|kslslkeiiligkell| BL:PDB:NREP 1 BL:PDB:REP 25->239|3f69B|3e-18|30.4|207/282| RP:PDB:NREP 1 RP:PDB:REP 13->281|3dk6A|1e-16|17.1|257/262| RP:PFM:NREP 1 RP:PFM:REP 22->265|PF00069|2e-20|32.8|235/256|Pkinase| HM:PFM:NREP 1 HM:PFM:REP 22->271|PF00069|3.7e-38|29.5|241/260|Pkinase| GO:PFM:NREP 3 GO:PFM GO:0004672|"GO:protein kinase activity"|PF00069|IPR017442| GO:PFM GO:0005524|"GO:ATP binding"|PF00069|IPR017442| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF00069|IPR017442| RP:SCP:NREP 1 RP:SCP:REP 6->265|1nw1A|1e-18|6.7|255/365|d.144.1.8| HM:SCP:REP 5->273|1howA_|6.5e-51|31.8|258/362|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 5293 OP:NHOMOORG 638 OP:PATTERN ------------------11--1----2---------------2--11-------1-6---1--1--- 3T*4O33333333347888-8822I98888887AABC6852TKY43334434446334225552F7DIKIH333333412127-------2--1--------------1--------22221122--------2--566CB---I2L6BC7785522------3369SOTF------------3134411211111111111111111-111111111111111122223221111111-1111111111111111111211111111111-11111111111111111111111111111111111111111111111111121122111111111111111111212111131111122111211111--1R-X----------42-------------------------------2-----111--1----1-1----1-11-----------1----2---------------------------------1-------1111111-------32------1-1212--1---55411212322-142-121-----------285-8243------11-----1-----DDBDj*-2--------------------------------53---1-1---11----1-------------2--------------------------------------------------------------2-2---------------------------2---------1-8-1----------------------1---42222211231-111--------------112------1-11--2-3--111----112---1111---------------1--11---1---11-1--11------------31 3222KR9-LAB5EID8A576676576432322355557775773349B7856866A64754489A699299A8AAAD8AB7AAABC79-AC8AB9B7478776NES2FAGUwxkrndJGE8EbJ*u9oD**o8lW*ADA8jANgL8PB9Fk72yGfhV*PgydOOLB*JPfIXHK58F3k56255LMSq7rD43MMMIC --------------------------------------------------------------------------------------------------------------------------------------------------------------------------3---- STR:NPRED 284 STR:RPRED 100.0 SQ:SECSTR HHcTTcccGGGETTcccGGGEEEEEEccTTccEEEEEEGGGTEEEEEEEcccTTccHHHHHHHHHHHTTcccTTcccEEEEEccEccccEEEEEccTTccHHHHHHHccTTTccHHHHHHHHHHHHHHHHHHHHTTEEcccccGGGEEEcGGGcEEEcTTcEEccTEHTTccEccTTccccGGGccHHHHHHcEEccGHHHHHHHHHHHHHHHHTTcccccTTccGGGHHHHHHTTccccccTTccHHHHHHHHHHTcccGGGccHcHHHHHHHHHHHHHHTcc DISOP:02AL 1-13,284-285| PSIPRED ccccccccHHHHHHccccEEEEEEEEEcccEEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccEEEEEEEccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEEcccEEEEccHHHHHccccccccccEEEEcccHHHccHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccHHHccHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHcccc //