[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49328.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->92 PF00520 * Ion_trans 0.00092 21.7 69/201  
:TM
:REPEAT 2|6->38|66->98

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49328.1 GT:GENE ABO49328.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 847448..847804 GB:FROM 847448 GB:TO 847804 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49328.1 GB:DB_XREF GI:134051357 LENGTH 118 SQ:AASEQ MSKFKKNIMSFIFTRHQLLSILTMVAISFLASFSTPEVAFADLDITASAKSVLSFFQLLIVLAAAKIITEFVGKGHLVPAVITVIAAAFLYVVIDPEIMKEIGGGIKALLKMKGSQTS GT:EXON 1|1-118:0| TM:NTM 3 TM:REGION 15->37| TM:REGION 45->67| TM:REGION 83->105| NREPEAT 1 REPEAT 2|6->38|66->98| HM:PFM:NREP 1 HM:PFM:REP 12->92|PF00520|0.00092|21.7|69/201|Ion_trans| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,115-119| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccc //